Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Tyrosine-protein phosphatase YopH (yopH)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P15273
Molecular weight:
52.10kDa

€210.00

50ug + 210 loyalty points
Met12–Ser399
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tyrosine-protein phosphatase YopH (yopH)

Tyrosine-protein phosphatase YopH (yopH)

Product name Tyrosine-protein phosphatase YopH (yopH)
Uniprot ID P15273
Uniprot link https://www.uniprot.org/uniprot/P15273
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANIVLT QEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSVLHAPGTPVREG LRSHLDPRTPPLPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRF RDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPDYFRQSGTYG SITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGS
Molecular weight 52.10kDa
Purity estimated 95% by SDS-PAGE
Buffer 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Ser399
Aliases /Synonyms Tyrosine-protein phosphatase YopH, Virulence protein
Reference PX-P4379
Note For research use only
Molecular Constructor
Met12–Ser399
Product name Tyrosine-protein phosphatase YopH (yopH)
Uniprot ID P15273
Uniprot link https://www.uniprot.org/uniprot/P15273
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANIVLT QEDTAKLLQSTVKHNLNNYELRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSVLHAPGTPVREG LRSHLDPRTPPLPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKLNRF RDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPVLAVLASSSEIANQRFGMPDYFRQSGTYG SITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGS
Molecular weight 52.10kDa
Purity estimated 95% by SDS-PAGE
Buffer 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Ser399
Aliases /Synonyms Tyrosine-protein phosphatase YopH, Virulence protein
Reference PX-P4379
Note For research use only
Molecular Constructor
Met12–Ser399

There are no reviews yet.

Be the first to review “Tyrosine-protein phosphatase YopH (yopH)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products