Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16455
Molecular weight:
38.40 kDa

Original price was: €290.00.Current price is: €259.00.

50ug 11% OFF + 259 loyalty points
Unknown Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein

Product name MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes
Product name MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P2087-1MG
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes

General information on MGMT Protein :

MGMT Portein, also known as Methylated-DNA–protein-cysteine methyltransferase (MGMT), is a protein encoded by the O6-methylguanine DNA methyltransferase gene. This protein is crucial for genome stability. MGMT protein is responsible of one of the rare mechanisms of direct DNA repair: the repair of the naturally occurring mutagenic DNA lesion O6-methylguanine back to guanine. The principal impact of MGMT is the removing of an alkyl from the O6-methylguanine. O6-methylguanine is a derivative of the nucleobase guanine which have a higher appetence for Thymine instead of Cytosine, causing errors during DNA replication.
MGMT protein is not a true enzyme. During the removing of the alkyl group from the lesion, the enzyme is not regenerated.
MGMT protein is present in every nuclear of human cells: Inactivation of the MGMT gene increase the chance of cancer emergence. The most common way of repression of the protein is by the methylation of its promoter region. According to different sources, 40% to 90% of colorectal cancers have reduced MGMT expression due to methylation of the MGMT promoter region. However, reduced or absent expression of MGMT would cause increased rates of mutation, and one or more of the mutated genes may provide the cell with a selective advantage. Many studies are focused on the expression of MGMT in different cancers like gastric carcinoma, metastatic pancreatic cancer or glioblastoma. Thanks to this important research around it, MGMT is a potential biomarker for chemotherapy response.

MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein

There are no reviews yet.

Be the first to review “MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products