Synthetic SNAP Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameSynthetic SNAP Protein
Uniprot IDP08515
Uniprot linkhttp://www.uniprot.org/uniprot/P08515
Origin speciessynthetic construction
Expression systemProkaryotic expression
SequenceMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD
Molecular weight45.44kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeUnknown
Protein AccessionAFU51890.1
Spec:SwissProtIDP08515
NCBI ReferenceAFU51890.1
Aliases /SynonymsSNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein
ReferencePX-P2096
NoteFor research use only

Description of Synthetic SNAP Protein

Generalities on SNAP Protein

Synaptosome nerve-associated protein also known as SNAP protein is component of SNARE protein complex. SNAP protein is involved in the exocytotic release of neurotransmitters during synaptic transmission. It is believed that SNAP protein controls exocytic and endocytic processes at the presynaptic terminal. Data suggests that SNAP protein is also implicated in postsynaptic receptor trafficking. However, a clear demonstration of SNAP protein localization in postsynaptic neuron is lacking. Even more so, since data suggests that this protein is located in the presynaptic location exclusively.

SNAP protein has also been suggested to play an important role in modulation of voltage-gated calcium channel-mediated (VGCC) signaling, short term plasticity, long term plasticity, dendritic spine morphogenesis, cognitive ability, learning and memory and network excitability. As such, deregulation of SNAP protein has been linked to several disorders such as early onset bipolar disorder, ADHD, increased risk of major depressive disorder and schizophrenia.

SNAP along with syntaxin and synaptobrevin (which are vesicle-associated membranes) have been implicated as central elements of an exocytotic membrane fusion complex in neurons. It is believed that SNAP protein binds directly to both synaptobrevin and syntaxin. Data suggests that SNAP is implicated in the final steps of intracellular membrane fusion.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Synthetic SNAP Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products