Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

LTA recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01374
Molecular weight:
20.57 kDa

Original price was: €388.00.Current price is: €329.00.

100ug 15% OFF + 329 loyalty points
Leu35–Leu205 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

LTA recombinant protein

Product name PX-P5015-100
Uniprot ID P01374
Uniprot link https://www.uniprot.org/uniprot/P01374
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Molecular weight 20.57 kDa
Protein delivered with Tag? His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Leu205
Protein Accession P01374
Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb
Reference PX-P5015
Note For research use only
Molecular Constructor
Leu35–Leu205 His
Product name PX-P5015-1MG
Uniprot ID P01374
Uniprot link https://www.uniprot.org/uniprot/P01374
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Molecular weight 20.57 kDa
Protein delivered with Tag? His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Leu205
Protein Accession P01374
Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb
Reference PX-P5015
Note For research use only
Molecular Constructor
Leu35–Leu205 His
Product name PX-P5015-50
Uniprot ID P01374
Uniprot link https://www.uniprot.org/uniprot/P01374
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Molecular weight 20.57 kDa
Protein delivered with Tag? His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Leu205
Protein Accession P01374
Aliases /Synonyms Lymphotoxin-alpha,LT-alpha,TNF-beta,Tumor necrosis factor ligand superfamily member 1, TNFb
Reference PX-P5015
Note For research use only
Molecular Constructor
Leu35–Leu205 His

LTA recombinant protein

There are no reviews yet.

Be the first to review “LTA recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products