Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

T cell receptor delta variable 1(TRDV1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A1B0GX56
Molecular weight:
13kDa

182.00

50ug + 182 loyalty points
Gln22–Glu115 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

T cell receptor delta variable 1(TRDV1)

Product name T cell receptor delta variable 1(TRDV1)
Uniprot ID A0A1B0GX56
Uniprot link https://www.uniprot.org/uniprot/A0A1B0GX56
Expression system Prokaryotic expression
Raw Antigen Sequence MQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEDYKDDDDKHHHHHHHH
Molecular weight 13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln22-Glu115
Protein Accession A0A1B0GX56
NCBI Reference A0A1B0GX56
Reference PX-P4655
Note For research use only
Molecular Constructor
Gln22–Glu115 His
Product name T cell receptor delta variable 1(TRDV1)
Uniprot ID A0A1B0GX56
Uniprot link https://www.uniprot.org/uniprot/A0A1B0GX56
Expression system Prokaryotic expression
Raw Antigen Sequence MQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGEDYKDDDDKHHHHHHHH
Molecular weight 13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln22-Glu115
Protein Accession A0A1B0GX56
NCBI Reference A0A1B0GX56
Reference PX-P4655
Note For research use only
Molecular Constructor
Gln22–Glu115 His

SDS-PAGE for T cell receptor delta variable 1(TRDV1)

SDS-PAGE for T cell receptor delta variable 1(TRDV1)

T cell receptor delta variable 1(TRDV1), on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “T cell receptor delta variable 1(TRDV1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products