Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Receptor-interacting serine, threonine-protein kinase 4(RIPK4)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P57078
Molecular weight:
57.6kDa

€329.00

100ug + 329 loyalty points
GST Phe22–Ile286
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Receptor-interacting serine, threonine-protein kinase 4(RIPK4)

Receptor-interacting serine, threonine-protein kinase 4(RIPK4)

Product name Receptor-interacting serine, threonine-protein kinase 4(RIPK4)
Uniprot ID P57078
Uniprot link https://www.uniprot.org/uniprot/P57078
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI
Molecular weight 57.6kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe22-Ile286
Protein Accession P57078
Spec:SwissProtID Q96KH0
NCBI Reference P57078
Aliases /Synonyms ANKRD3, DIK，Ankyrin repeat domain-containing protein 3，PKC-delta-interacting protein kinase
Reference PX-P4863
Note For research use only
Molecular Constructor
GST Phe22–Ile286
Product name Receptor-interacting serine, threonine-protein kinase 4(RIPK4)
Uniprot ID P57078
Uniprot link https://www.uniprot.org/uniprot/P57078
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI
Molecular weight 57.6kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >80% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe22-Ile286
Protein Accession P57078
Spec:SwissProtID Q96KH0
NCBI Reference P57078
Aliases /Synonyms ANKRD3, DIK，Ankyrin repeat domain-containing protein 3，PKC-delta-interacting protein kinase
Reference PX-P4863
Note For research use only
Molecular Constructor
GST Phe22–Ile286

There are no reviews yet.

Be the first to review “Receptor-interacting serine, threonine-protein kinase 4(RIPK4)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products