Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Palivizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Palivizumab ELISA Kit

Palivizumab ELISA Kit

Product name Palivizumab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX284
Note For research use only.
Sample type Plasma, Serum
Target Palivizumab
Immunogen Palivizumab

Introduction to Palivizumab ELISA Kit

Palivizumab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection of Palivizumab, a monoclonal antibody, in biological samples. This kit is widely used in research and clinical settings to measure the levels of Palivizumab in patient samples, making it an essential tool for therapeutic target identification and monitoring.

Structure of Palivizumab ELISA Kit

The Palivizumab ELISA Kit is based on the principle of Enzyme-Linked Immunosorbent Assay (ELISA). It consists of a 96-well microplate coated with a specific anti-Palivizumab antibody. The kit also includes a set of standards, controls, and reagents necessary for the assay.

The Palivizumab ELISA Kit is a sandwich ELISA, where the captured antibody on the microplate binds to Palivizumab in the sample, forming a complex. This complex is then detected by a second enzyme-labeled antibody specific for Palivizumab. The intensity of the color produced is directly proportional to the amount of Palivizumab present in the sample.

Activity of Palivizumab ELISA Kit

The Palivizumab ELISA Kit has a high sensitivity and specificity, with a detection limit of 0.5 ng/mL. This allows for accurate and precise quantification of Palivizumab levels in various biological samples, including serum, plasma, and cell culture supernatants.

The assay can be completed within 3 hours, making it a time-efficient tool for high-throughput screening. It also has a wide dynamic range, allowing for the detection of both low and high levels of Palivizumab in samples.

Application of Palivizumab ELISA Kit

The Palivizumab ELISA Kit has various applications in both research and clinical settings. It is primarily used for the evaluation of Palivizumab therapy in patients with respiratory syncytial virus (RSV) infection. RSV is a common cause of respiratory tract infections, especially in infants and young children. Palivizumab is an FDA-approved monoclonal antibody used for the prevention of severe RSV infection in high-risk infants.

In research, the Palivizumab ELISA Kit is used for the identification and validation of Palivizumab as a therapeutic target for RSV infection. It is also used for the measurement of Palivizumab levels in preclinical studies to assess its pharmacokinetics and pharmacodynamics.

In clinical settings, the Palivizumab ELISA Kit is used to monitor the levels of Palivizumab in patients undergoing therapy. This allows for the optimization of dosing and ensures that patients are receiving the appropriate amount of Palivizumab for effective treatment.

Conclusion

The Palivizumab ELISA Kit is a valuable tool for the detection and quantification of Palivizumab in various biological samples. Its high sensitivity, specificity, and wide dynamic range make it a reliable and efficient method for Palivizumab analysis. With its various applications in research and clinical settings, the Palivizumab ELISA Kit plays a crucial role in the development and monitoring of Palivizumab therapy for RSV infection.

Palivizumab ELISA Kit

There are no reviews yet.

Be the first to review “Palivizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products