Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tocilizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Tocilizumab ELISA Kit

Tocilizumab ELISA Kit

Product name Tocilizumab ELISA Kit
Uniprot ID P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX164
Note For research use only.
Sample type Plasma, Serum
Target Tocilizumab
Immunogen Tocilizumab

Tocilizumab ELISA Kit: A Comprehensive Guide Introduction

Tocilizumab is a humanized monoclonal antibody that specifically targets the interleukin-6 (IL-6) receptor. It is used as a therapeutic agent for the treatment of various inflammatory diseases, including rheumatoid arthritis, systemic juvenile idiopathic arthritis, and cytokine release syndrome. The Tocilizumab ELISA Kit is a highly sensitive and reliable tool for the detection and quantification of Tocilizumab in biological samples. In this article, we will provide a detailed description of the structure, activity, and application of this ELISA Kit.

Structure of Tocilizumab

Tocilizumab is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 148 kDa. The antibody is produced by recombinant DNA technology using Chinese hamster ovary (CHO) cells. It binds to the IL-6 receptor with high affinity, preventing IL-6 from binding to its receptor and inhibiting downstream signaling pathways.

Activity of Tocilizumab

Tocilizumab exerts its therapeutic effects by blocking the activity of IL-6, a pro-inflammatory cytokine that plays a key role in the pathogenesis of various inflammatory diseases. IL-6 is produced by a variety of cells, including immune cells, and is involved in the regulation of immune responses, hematopoiesis, and acute-phase reactions. Overproduction of IL-6 has been linked to the development of autoimmune disorders and chronic inflammatory conditions. By blocking the IL-6 receptor, Tocilizumab inhibits the downstream signaling pathways, leading to reduced inflammation and improved clinical outcomes.

Application of Tocilizumab ELISA Kit

The Tocilizumab ELISA Kit is a valuable tool for the detection and quantification of Tocilizumab in various biological samples, including serum, plasma, and cell culture supernatants. It is a highly sensitive and specific assay that utilizes the sandwich ELISA principle, where Tocilizumab is captured by a specific anti-Tocilizumab antibody coated on the microplate wells, and then detected by a second biotinylated anti-Tocilizumab antibody and streptavidin-HRP conjugate. The colorimetric signal is then measured and quantified using a microplate reader, with the intensity of the signal directly proportional to the amount of Tocilizumab present in the sample.

The Tocilizumab ELISA Kit is widely used in clinical and research settings for the measurement of Tocilizumab levels in patient samples. It is an essential tool for monitoring Tocilizumab therapy and assessing treatment response in patients with inflammatory diseases. In addition, the kit can also be used for pharmacokinetic studies to determine the pharmacokinetic parameters of Tocilizumab, such as peak serum concentration and elimination half-life.

Conclusion

The Tocilizumab ELISA Kit is a valuable tool for the detection and quantification of Tocilizumab, a humanized monoclonal antibody used as a therapeutic agent for the treatment of inflammatory diseases. The kit provides a reliable and sensitive method for monitoring Tocilizumab therapy and assessing treatment response in patients. Its wide range of applications makes it an essential tool for both clinical and research settings. With its high specificity and sensitivity, the Tocilizumab ELISA Kit is a crucial asset in the field of immunology and drug development.

Keywords: Tocilizumab, ELISA Kit, antibody, therapeutic target, IL-6 receptor, inflammatory diseases

Tocilizumab ELISA Kit

There are no reviews yet.

Be the first to review “Tocilizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products