Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sirukumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Sirukumab ELISA Kit

Sirukumab ELISA Kit

Product name Sirukumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX151
Note For research use only.
Sample type Plasma, Serum
Target Sirukumab
Immunogen Sirukumab

Title: Understanding the Structure and Function of Sirukumab ELISA Kit: A Revolutionary Tool for Antibody Detection

Introduction:

Sirukumab ELISA Kit is a cutting-edge technology that has revolutionized the field of antibody detection. It is a highly sensitive and specific tool for measuring the levels of Sirukumab, a therapeutic antibody, in various biological samples. In this article, we will delve into the structure, activity, and application of Sirukumab ELISA Kit in detail.

Structure of Sirukumab ELISA Kit:

The Sirukumab ELISA Kit is composed of several components that work together to accurately detect the presence of Sirukumab in a sample. The primary component is the capture antibody, which is coated on the surface of the microplate wells. This antibody specifically binds to Sirukumab and immobilizes it on the plate. The detection antibody, which is labeled with an enzyme, is then added to the plate and binds to the captured Sirukumab. Finally, a substrate solution is added, which reacts with the enzyme to produce a color change that can be measured and quantified using a spectrophotometer.

Activity of Sirukumab ELISA Kit:

The Sirukumab ELISA Kit is a highly sensitive and specific assay that can detect Sirukumab at very low concentrations. The capture and detection antibodies used in the kit have been carefully selected and validated to ensure high affinity and specificity for Sirukumab. The enzyme labeling of the detection antibody allows for signal amplification, resulting in a more sensitive detection of Sirukumab. The entire process is performed in a controlled and standardized manner, ensuring reproducibility and accuracy of results.

Application of Sirukumab ELISA Kit:

The primary application of Sirukumab ELISA Kit is in the field of drug development and clinical research. It is used to measure the levels of Sirukumab in various biological samples, such as serum, plasma, and cell culture supernatants. This information is crucial in determining the pharmacokinetics and pharmacodynamics of Sirukumab, which is essential for drug development. Additionally, the Sirukumab ELISA Kit can also be used to monitor the levels of Sirukumab in patients undergoing treatment with this therapeutic antibody. This allows for personalized dosing and monitoring of treatment efficacy.

Advantages of Sirukumab ELISA Kit:

The Sirukumab ELISA Kit offers several advantages over traditional methods of antibody detection. Firstly, it is a highly sensitive assay, capable of detecting Sirukumab at concentrations as low as 0.1 ng/mL. This makes it ideal for measuring the levels of Sirukumab in biological samples, where the concentration of the antibody may be very low. Secondly, the kit is highly specific, with minimal cross-reactivity with other antibodies. This ensures accurate and reliable results. Finally, the Sirukumab ELISA Kit is a user-friendly and cost-effective tool, making it accessible to a wide range of researchers and clinicians.

Conclusion:

In conclusion, the Sirukumab ELISA Kit is a powerful tool for detecting and quantifying Sirukumab in various biological samples. Its unique structure, high sensitivity and specificity, and wide range of applications make it an indispensable tool for drug development and clinical research. With the increasing use of therapeutic antibodies in the treatment of various diseases, the Sirukumab ELISA Kit is poised to play a crucial role in advancing medical research and improving patient care.

Sirukumab ELISA Kit

There are no reviews yet.

Be the first to review “Sirukumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products