Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ziltivekimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ziltivekimab ELISA Kit

Ziltivekimab ELISA Kit

Product name Ziltivekimab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX152
Note For research use only.
Sample type Plasma, Serum
Target Ziltivekimab
Immunogen Ziltivekimab

Introduction:

Ziltivekimab is a novel monoclonal antibody that has recently gained attention as a potential therapeutic target for various inflammatory diseases. This antibody specifically targets a protein called interleukin-6 (IL-6), which is known to play a crucial role in the pathogenesis of several chronic inflammatory conditions. The Ziltivekimab ELISA Kit is a specialized tool designed to detect and quantify the levels of this antibody in various biological samples, providing valuable insights into its structure, activity, and potential applications.

Structure of Ziltivekimab:

Ziltivekimab is a humanized IgG1 monoclonal antibody that has been engineered to specifically bind to IL-6 with high affinity. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the target protein, while the constant regions provide stability and effector functions. The structure of Ziltivekimab has been optimized to enhance its binding affinity and minimize potential immunogenicity, making it a safe and effective therapeutic agent.

Activity of Ziltivekimab:

Ziltivekimab exerts its activity by specifically binding to IL-6 and blocking its interaction with its receptor. This prevents the signaling cascade that leads to the production of pro-inflammatory cytokines and chemokines, thereby reducing inflammation. In addition, Ziltivekimab also promotes the clearance of IL-6 from circulation by activating the complement system, a part of the immune system responsible for eliminating foreign substances. This dual mechanism of action makes Ziltivekimab a potent inhibitor of IL-6 and a promising therapeutic target for various inflammatory diseases.

Application of Ziltivekimab ELISA Kit:

The Ziltivekimab ELISA Kit is a valuable tool for researchers and clinicians to detect and measure the levels of this antibody in various biological samples. It utilizes a sandwich ELISA technique, where the target antibody is captured by a specific antibody coated on the plate and then detected by a second antibody labeled with an enzyme. This results in a color change that is directly proportional to the amount of Ziltivekimab present in the sample. The kit is highly sensitive, with a detection limit of as low as 0.1 ng/mL, making it suitable for both research and clinical applications.

Potential therapeutic applications of Ziltivekimab:

Ziltivekimab has shown promising results in preclinical and clinical studies for the treatment of various inflammatory conditions, including rheumatoid arthritis, systemic lupus erythematosus, and inflammatory bowel disease. In addition, it has also been investigated for its potential in treating severe COVID-19 cases, as IL-6 is known to play a key role in the cytokine storm associated with the disease. The Ziltivekimab ELISA Kit can be used to monitor the levels of this antibody in patients receiving treatment, providing valuable information on its pharmacokinetics and efficacy.

Conclusion:

In summary, Ziltivekimab is a promising monoclonal antibody that specifically targets IL-6 and has the potential to treat various inflammatory diseases. The Ziltivekimab ELISA Kit is a specialized tool that can accurately detect and quantify this antibody, providing valuable insights into its structure, activity, and potential applications. Further research and clinical trials are needed to fully realize the therapeutic potential of Ziltivekimab, but the ELISA Kit serves as an important tool in this process.

Ziltivekimab ELISA Kit

There are no reviews yet.

Be the first to review “Ziltivekimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products