Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Labetuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Labetuzumab ELISA Kit

Labetuzumab ELISA Kit

Product name Labetuzumab ELISA Kit
Uniprot ID P06731
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX154
Note For research use only.
Sample type Plasma, Serum
Target Labetuzumab
Immunogen Labetuzumab

The Structure of Labetuzumab ELISA Kit

Labetuzumab ELISA Kit is a highly specific and sensitive diagnostic tool used for the detection and quantification of Labetuzumab, a monoclonal antibody used as a therapeutic target for various types of cancer. The kit is designed to measure the levels of Labetuzumab in biological samples such as serum, plasma, and cell culture supernatants.

The kit contains all the necessary components for a sandwich enzyme-linked immunosorbent assay (ELISA) test, including pre-coated microplates, Labetuzumab-specific antibodies, and enzyme-conjugated secondary antibodies. The microplates are coated with a highly purified and specific Labetuzumab capture antibody, which is able to bind to the target antigen with high affinity and specificity.

The Activity of Labetuzumab ELISA Kit

The Labetuzumab ELISA Kit utilizes the principle of sandwich ELISA, which involves the use of two different antibodies that bind to different epitopes on the target antigen. The first antibody, the capture antibody, is immobilized on the surface of the microplate and is able to capture the target antigen from the sample. The second antibody, the detection antibody, is conjugated to an enzyme and is able to bind to a different epitope on the target antigen.

The captured antigen is then detected by the enzyme-conjugated detection antibody, which produces a measurable signal when it comes into contact with a substrate. The intensity of the signal is directly proportional to the amount of Labetuzumab present in the sample, allowing for accurate quantification of the target antigen.

The Application of Labetuzumab ELISA Kit

Labetuzumab ELISA Kit has a wide range of applications in the field of cancer research and drug development. It is primarily used for the detection and quantification of Labetuzumab in clinical samples, making it a valuable tool for monitoring the effectiveness of Labetuzumab-based therapies.

The kit can also be used for the screening and characterization of Labetuzumab in cell culture supernatants and other biological samples. This allows for the identification of potential therapeutic candidates and the optimization of production processes for Labetuzumab.

Furthermore, Labetuzumab ELISA Kit can be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of Labetuzumab. This information is crucial for the development of new Labetuzumab-based therapies and for the determination of appropriate dosages for clinical trials.

In addition to its applications in research and drug development, Labetuzumab ELISA Kit can also be used in clinical settings for the diagnosis and monitoring of Labetuzumab-responsive cancers, such as colorectal cancer and pancreatic cancer. The kit provides a quick, accurate, and cost-effective method for measuring Labetuzumab levels, allowing for early detection and personalized treatment plans for patients.

Conclusion

In summary, Labetuzumab ELISA Kit is a highly specialized and sensitive diagnostic tool that plays a crucial role in the detection, quantification, and monitoring of Labetuzumab in various biological samples. Its unique sandwich ELISA design and high specificity make it a valuable tool for cancer research, drug development, and clinical applications. With its ability to accurately measure Labetuzumab levels, this kit has the potential to improve patient outcomes and contribute to the development of new and effective therapies for Labetuzumab-responsive cancers.

Labetuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Labetuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products