Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA1905-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-kappa(Slience)

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade

Product name MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody
Product name MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody
Product name PX-TA1905-50
Uniprot ID Q969D9
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody

The Structure of MOR014824 Biosimilar – Anti-TSLP mAb

MOR014824 Biosimilar – Anti-TSLP mAb is a monoclonal antibody (mAb) that specifically targets the cytokine thymic stromal lymphopoietin (TSLP). It is a biosimilar version of the original anti-TSLP mAb, designed to have a similar structure and function.

The antibody is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. Each chain consists of constant and variable regions. The variable regions are responsible for binding to TSLP, while the constant regions determine the antibody’s effector functions.

The Activity of MOR014824 Biosimilar – Anti-TSLP mAb

TSLP is a cytokine that plays a crucial role in the regulation of immune responses and inflammation. It is produced by various cell types, including epithelial cells, dendritic cells, and mast cells. TSLP binds to its receptor, which is composed of the TSLP receptor (TSLPR) and the IL-7 receptor alpha chain (IL-7Rα), to activate downstream signaling pathways.

MOR014824 Biosimilar – Anti-TSLP mAb specifically binds to TSLP and blocks its interaction with the TSLPR/IL-7Rα receptor complex. This prevents the activation of downstream signaling pathways and inhibits the pro-inflammatory effects of TSLP. By neutralizing TSLP, MOR014824 Biosimilar – Anti-TSLP mAb can reduce inflammation and modulate immune responses.

The Application of MOR014824 Biosimilar – Anti-TSLP mAb

MOR014824 Biosimilar – Anti-TSLP mAb has potential therapeutic applications in various inflammatory and autoimmune diseases. TSLP has been implicated in the pathogenesis of conditions such as asthma, atopic dermatitis, and inflammatory bowel disease. By targeting TSLP, MOR014824 Biosimilar – Anti-TSLP mAb can potentially alleviate symptoms and improve outcomes in these diseases.

In addition, TSLP has been shown to play a role in cancer progression and metastasis. It promotes tumor growth and angiogenesis, as well as suppresses anti-tumor immune responses. Therefore, MOR014824 Biosimilar – Anti-TSLP mAb may also have potential as an anti- cancer therapy.

Furthermore, MOR014824 Biosimilar – Anti-TSLP mAb can be used as a research tool to study the role of TSLP in various diseases and to develop new therapeutic strategies targeting this cytokine.

Conclusion

In summary, MOR014824 Biosimilar – Anti-TSLP mAb is a monoclonal antibody that specifically targets the cytokine TSLP. It blocks the interaction between TSLP and its receptor, thereby inhibiting pro-inflammatory effects and modulating immune responses. This biosimilar version of the original anti-TSLP mAb has potential therapeutic applications in inflammatory and autoimmune diseases, as well as in cancer. It can also serve as a valuable research tool in the study of TSLP.

Research Grade Anti-Human TSLP (HU23B12) binds to Mouse TSLP recombinant protein in ELISA Assay

Research Grade Anti-Human TSLP (HU23B12) binds to Mouse TSLP recombinant protein in ELISA Assay

Mouse TSLP recombinant protein(cat. No.PX-P6400) at 0.5µg/mL (100µL/well) can bind Research Grade Anti-Human TSLP (HU23B12) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Anti-Human TSLP (HU23B12)

SDS-PAGE for Research Grade Anti-Human TSLP (HU23B12)

Research Grade Anti-Human TSLP (HU23B12), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products