Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rinatabart Biosimilar – Anti-Folate receptor alpha mAb – Research Grade

  • PX-TA2207-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade

Product name PX-TA2207-50
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Rinatabart Biosimilar - Anti-Folate receptor alpha mAb - Research Grade
Uniprot ID P15328
Source CAS: 2853518-94-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2207-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction
Rinatabart Biosimilar is a therapeutic antibody that specifically targets the folate receptor alpha (FRα), a protein that is overexpressed in various types of cancer cells. This biosimilar is a research grade product that has been designed to mimic the structure and function of the original anti-FRα monoclonal antibody (mAb) and has potential applications in cancer treatment.

Structure of Rinatabart Biosimilar
Rinatabart Biosimilar is a recombinant, humanized mAb that is composed of two heavy chains and two light chains. The heavy chains consist of constant and variable regions, while the light chains only have variable regions. The variable regions of both the heavy and light chains are responsible for binding to the FRα protein.

Activity of Rinatabart Biosimilar
The primary function of Rinatabart Biosimilar is to bind to the FRα protein and inhibit its activity. FRα is a cell surface receptor that plays a crucial role in the uptake of folic acid, a necessary nutrient for cell growth and division. However, in cancer cells, FRα is overexpressed and contributes to the rapid growth and proliferation of these cells. By targeting and binding to FRα, Rinatabart Biosimilar blocks the uptake of folic acid and disrupts the growth and survival of cancer cells.

Additionally, Rinatabart Biosimilar can also induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms involve the activation of immune cells to attack and destroy cancer cells that have been bound by the biosimilar. This activity enhances the anti-tumor effects of Rinatabart Biosimilar and makes it a promising therapeutic option for cancer treatment.

Application of Rinatabart Biosimilar
Rinatabart Biosimilar has potential applications in the treatment of various types of cancer, including ovarian, lung, breast, and colorectal cancer. These types of cancer are known to overexpress FRα, making it an ideal therapeutic target for Rinatabart Biosimilar. Additionally, the biosimilar can also be used in combination with other anti-cancer drugs to enhance their effectiveness.

Rinatabart Biosimilar is currently being evaluated in preclinical and clinical studies to determine its safety and efficacy as a cancer treatment. The results of these studies have shown promising results, with significant tumor regression and improved patient outcomes. Further clinical trials are ongoing to assess the potential of Rinatabart Biosimilar in different types of cancer and to obtain regulatory approval for its use in cancer therapy.

Conclusion
In conclusion, Rinatabart Biosimilar is a research grade therapeutic antibody that specifically targets the folate receptor alpha, a protein overexpressed in various types of cancer cells. Its unique structure and activity make it a promising candidate for cancer treatment, and preclinical and clinical studies have shown positive results. With ongoing research and development, Rinatabart Biosimilar has the potential to become a valuable addition to the arsenal of anti-cancer drugs and improve patient outcomes.

SDS-PAGE for Rinatabart Biosimilar - Research Grade

SDS-PAGE for Rinatabart Biosimilar - Research Grade

Rinatabart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Rinatabart Biosimilar - Research Grade in ELISA Assay

Rinatabart Biosimilar - Research Grade in ELISA Assay

Rinatabart Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Rinatabart Biosimilar – Anti-Folate receptor alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products