Brand: ProteoGenix

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

PX-TA1021-100UG
Validated ELISA

Isotype:: IgG1, kappa

Original price was: €144.00.Current price is: €120.00.

100ug 17% OFF + 120 loyalty points

Size Size

50ug Original price was: €113.00.Current price is: €84.00.
100ug Original price was: €144.00.Current price is: €120.00.
1MG Original price was: €360.00.Current price is: €265.00.
10mg Original price was: €1,815.00.Current price is: €1,325.00.
25mg Original price was: €3,342.00.Current price is: €2,785.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade binds to Mouse CTLA-4 recombinant protein in ELISA Assay

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	PX-TA1021-50
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1, kappa

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

Product name	Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID	P16410
Source	DrugBank DB06186
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight	148kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference	PX-TA1021
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG1Kappa
Clonality	Monoclonal Antibody

General information about Ipilimumab

Ipilimumab is a monoclonal antibody used in the treatment of melanoma. It is an antibody that inhibits the CTLA-4 checkpoint of T lymphocytes, a checkpoint that certain cancers activate to decrease the efficiency of the lymphocyte. Ipilimumab is a human monoclonal antibody of the IgG1 type directed against the CTLA-4 protein (Cytotoxic T-Lymphocyte Antigen 4). The inhibition of this receptor present on the T lymphocytes results in the activation of the T lymphocyte. This product is for research use only.

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade binds to Mouse CTLA-4 recombinant protein in ELISA Assay

Mouse CTLA-4 recombinant protein(cat. No.PX-P6063) at 0.5Âµg/mL (100ÂµL/well) can bind Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.