Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade

  • PX-TA1021-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: €113.00.Current price is: €84.00.

50ug 26% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1021-50
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade
Uniprot ID P16410
Source DrugBank DB06186
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ipilimumab,Ipilimumab,CTLA-4,anti-CTLA-4
Reference PX-TA1021
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody

General information about Ipilimumab

Ipilimumab is a monoclonal antibody used in the treatment of melanoma. It is an antibody that inhibits the CTLA-4 checkpoint of T lymphocytes, a checkpoint that certain cancers activate to decrease the efficiency of the lymphocyte. Ipilimumab is a human monoclonal antibody of the IgG1 type directed against the CTLA-4 protein (Cytotoxic T-Lymphocyte Antigen 4). The inhibition of this receptor present on the T lymphocytes results in the activation of the T lymphocyte. This product is for research use only.

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

SEC-HPLC of Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

SDS-PAGE for Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ipilimumab Biosimilar - Anti-CTLA-4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ipilimumab Biosimilar – Anti-CTLA-4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products