Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ipilimumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ipilimumab ELISA Kit

Ipilimumab ELISA Kit

Product name Ipilimumab ELISA Kit
Uniprot ID P16410
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX195
Note For research use only.
Sample type Plasma, Serum
Target Ipilimumab
Immunogen Ipilimumab

Introduction

Ipilimumab is a monoclonal antibody therapy that has been approved by the US Food and Drug Administration (FDA) for the treatment of advanced melanoma. It works by targeting a protein called cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), which is a key regulator of the immune response. Ipilimumab is a valuable tool in the fight against cancer, and its activity can be accurately measured using an enzyme-linked immunosorbent assay (ELISA) kit.

Structure of Ipilimumab

Ipilimumab is a fully human monoclonal antibody, meaning that it is derived from human cells and is less likely to cause an immune response in patients. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The antibody has a molecular weight of approximately 148 kDa and is produced by recombinant DNA technology.

Activity of Ipilimumab

Ipilimumab works by binding to CTLA-4 on the surface of T cells, which are a type of white blood cell involved in the immune response. CTLA-4 normally acts as a brake on the immune system, preventing it from attacking healthy cells. However, in cancer, this brake is often overactive, allowing tumors to evade detection by the immune system. By blocking CTLA-4, ipilimumab allows the immune system to recognize and attack cancer cells.

Application of Ipilimumab ELISA Kit

The Ipilimumab ELISA Kit is a valuable tool for measuring the levels of ipilimumab in patient samples. This can provide important information about the effectiveness of treatment and help guide dosing decisions. The kit is designed for use with human serum or plasma samples and can accurately measure ipilimumab concentrations as low as 0.1 ng/mL.

Principle of the ELISA Kit

The Ipilimumab ELISA Kit uses a sandwich enzyme-linked immunosorbent assay format. This means that the antibody-coated plate is first incubated with the patient sample, allowing any ipilimumab present to bind to the plate. After washing away any unbound material, a second antibody specific for ipilimumab is added, followed by an enzyme-linked detection antibody. The amount of ipilimumab present in the sample is then determined by measuring the activity of the enzyme.

Advantages of the ELISA Kit

The Ipilimumab ELISA Kit offers several advantages over other methods of measuring ipilimumab levels. It is a highly sensitive and specific assay, allowing for accurate and reproducible results. It is also a cost-effective option, as it does not require specialized equipment and can be performed in a standard laboratory setting. Additionally, the kit has a short incubation time, allowing for quick and efficient analysis of multiple samples.

Clinical Significance of Ipilimumab ELISA Kit

Measuring ipilimumab levels using the ELISA Kit has important clinical significance. It can help clinicians determine the optimal dose of ipilimumab for each patient, as well as monitor the response to treatment. This can be particularly useful in patients who experience side effects or do not respond to the standard dose of ipilimumab. In addition, the kit can also be used to detect the presence of anti-drug antibodies, which can impact the effectiveness of treatment.

Conclusion

In conclusion, ipilimumab is a valuable monoclonal antibody therapy for the treatment of advanced melanoma. The Ipilimumab ELISA Kit is a reliable and accurate tool for measuring ipilimumab levels in patient samples, providing important information for treatment decisions. With its high sensitivity, cost-effectiveness, and clinical significance, the ELISA Kit is an essential component in the use of ipilimumab as a therapeutic target for cancer.

Ipilimumab ELISA Kit

There are no reviews yet.

Be the first to review “Ipilimumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products