Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD86, B7-2 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P42081
Molecular weight:
28.92kDa

Original price was: €235.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD86, B7-2 recombinant protein

Product name Human CD86, B7-2 recombinant protein
Uniprot ID P42081
Uniprot link http://www.uniprot.org/uniprot/P42081
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH
Molecular weight 28.92kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2
Reference PX-P4041
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD86, B7-2 recombinant protein
Uniprot ID P42081
Uniprot link http://www.uniprot.org/uniprot/P42081
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH
Molecular weight 28.92kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2
Reference PX-P4041
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4041-1MG
Uniprot ID P42081
Uniprot link http://www.uniprot.org/uniprot/P42081
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH
Molecular weight 28.92kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2
Reference PX-P4041
Note For research use only
Molecular Constructor
Partial Yes

General Information about Human CD86/B7-2 recombinant protein

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein expressed in antigen presenting cells, which provides co-stimulatory signals necessary for T cell activation and survival. It is a ligand for two different proteins on the cell surface. T: CD28 (for self-regulation and cell-cell binding) and CTLA-4 (to attenuate cell regulation and separation). CD86 and CD80 act together on primary T cells. This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. The protein is expressed because it contains antigens, and is a ligand for two proteins on the surface of T cells, the CD28 antigen and the cytotoxic T lymph.

Human CD86, B7-2 recombinant protein

There are no reviews yet.

Be the first to review “Human CD86, B7-2 recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products