Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CTLA-4 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P09793
Molecular weight:
13.75 kDa

420.00

100ug + 420 loyalty points
Ala37–Asp161 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CTLA-4 recombinant protein

Product name Mouse CTLA-4 recombinant protein
Uniprot ID P09793
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Molecular weight 13.75 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Asp161
Aliases /Synonyms Cd152
Reference PX-P6063
Note For research use only.
Molecular Constructor
Ala37–Asp161 His

Mouse CTLA-4 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CTLA-4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products