Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Immunoglobulin G-binding protein G(spg)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P19909
Molecular weight:
20.96KDa（25-35kDa)

€210.00

50ug + 210 loyalty points
Lys314~Glu497
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Immunoglobulin G-binding protein G(spg)

Immunoglobulin G-binding protein G(spg)

Product name Immunoglobulin G-binding protein G(spg)
Uniprot ID P19909
Uniprot link http://www.uniprot.org/uniprot/P19909
Expression system Prokaryotic expression
Sequence KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight 20.96KDa（25-35kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314~Glu497
Aliases /Synonyms IgG-binding protein G
Reference PX-P4551
Note For research use only
Molecular Constructor
Lys314~Glu497
Product name Immunoglobulin G-binding protein G(spg)
Uniprot ID P19909
Uniprot link http://www.uniprot.org/uniprot/P19909
Expression system Prokaryotic expression
Sequence KGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Molecular weight 20.96KDa（25-35kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys314~Glu497
Aliases /Synonyms IgG-binding protein G
Reference PX-P4551
Note For research use only
Molecular Constructor
Lys314~Glu497

There are no reviews yet.

Be the first to review “Immunoglobulin G-binding protein G(spg)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products