Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Drosophila Hh Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Drosophila
Uniprot ID:
B4R1D8
Molecular weight:
21,27 kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Drosophila Hh Recombinant Protein

Product name Drosophila Hh Recombinant Protein
Uniprot ID B4R1D8
Uniprot link http://www.uniprot.org/uniprot/B4R1D8
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEE GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGF DWVSYVSRRHIYCSVKSDSSISSHVHG
Molecular weight 21,27 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002104521.1
Spec:Entrez GeneID 6729200
Spec:NCBI Gene Aliases GD18403, dsim_GLEANR_2228
Spec:SwissProtID B4R1D8
NCBI Reference XP_002104521.1
Aliases /Synonyms Hh, hedgehog
Reference PX-P1110
Note For research use only
Molecular Constructor
Partial Yes
Product name Drosophila Hh Recombinant Protein
Uniprot ID B4R1D8
Uniprot link http://www.uniprot.org/uniprot/B4R1D8
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEE GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGF DWVSYVSRRHIYCSVKSDSSISSHVHG
Molecular weight 21,27 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002104521.1
Spec:Entrez GeneID 6729200
Spec:NCBI Gene Aliases GD18403, dsim_GLEANR_2228
Spec:SwissProtID B4R1D8
NCBI Reference XP_002104521.1
Aliases /Synonyms Hh, hedgehog
Reference PX-P1110
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1110-1MG
Uniprot ID B4R1D8
Uniprot link http://www.uniprot.org/uniprot/B4R1D8
Origin species Drosophila
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLAHSCGPGRGLGRHRARNLYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEE GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGF DWVSYVSRRHIYCSVKSDSSISSHVHG
Molecular weight 21,27 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XP_002104521.1
Spec:Entrez GeneID 6729200
Spec:NCBI Gene Aliases GD18403, dsim_GLEANR_2228
Spec:SwissProtID B4R1D8
NCBI Reference XP_002104521.1
Aliases /Synonyms Hh, hedgehog
Reference PX-P1110
Note For research use only
Molecular Constructor
Partial Yes

Drosophila Hh Recombinant Protein

There are no reviews yet.

Be the first to review “Drosophila Hh Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products