Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

PCNA protein – Proliferating cell nuclear antigen

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P12004

329.00

100ug + 329 loyalty points
Met1–Ser261
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

PCNA protein - Proliferating cell nuclear antigen

Product name PCNA protein - Proliferating cell nuclear antigen
Uniprot ID P12004
Uniprot link https://www.uniprot.org/uniprot/P12004
Expression system Prokaryotic expression
Sequence MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGSLEHHHHHH
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser261
Aliases /Synonyms PCNA,Cyclin
Reference PX-P4847
Note For research use only
Molecular Constructor
Met1–Ser261
Product name PCNA protein - Proliferating cell nuclear antigen
Uniprot ID P12004
Uniprot link https://www.uniprot.org/uniprot/P12004
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGSLEHHHHHH
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser261
Aliases /Synonyms PCNA,Cyclin
Reference PX-P4847
Note For research use only
Molecular Constructor
Met1–Ser261

General Information about PCNA Protein

PCNA protein also known as proliferating cell nuclear antigen is a DNA clamp and a catalyzer of DNA polymerase delta. PCNA protein is essential for the replication of eukaryotic cells. The protein is a homotrimer which increase it processivity towards DNA polymerase delta. PCNA protein encircles the DNA and acts as a scaffold to recruit proteins implicated in DNA repair, DNA chromatin remodeling, DNA replication and is involved in epigenetics. PCNA protein contains two PCNA-interacting motifs, the PCNA-interacting peptide (PIP) bx and AlkB homologue 2 PCNA interacting motif (APIM). The proteins that interact with PCNA via PIP box are mainly involved in DNA replication. On the other hand, the proteins that bind to APIM box of PCNA protein are believed to be involved in genotoxic stress. The PCNA protein is ubiquitinated following DNA damage. The protein is also involved in RAD6-dependent DNA repair pathway.
PCNA protein holds DNA polymerase attached to DNA. The former is involved in re-synthesis of damaged DNA that has been excised. As such, PCNA protein is involved in both DNA repair and DNA synthesis. Furthermore, the protein is implicated in DNA damage tolerance pathways which is also known as post-replication repair or PRR. PRR consists of two pathways; (1) a translesion pathway which is carried out special DNA polymerases that incorporate DNA bases into their active sites and (2) a ‘template switch’ pathway which involves the recruitment of the homologous recombination machinery. PCNA protein activates these pathways depending on what is required for the cell. PCNA protein is ubiquinated post-translationally. Mono-ubiquitin on lysine 164 leads to PCNA activation of translesion pathways. Extension of the mono-ubiquitin by a non-canonical lysine-63-linked poly-ubiquitin chain is believed to be implicated in the activation of the template switch pathway. However, sumoylation of PCNA lysine 164 inhibts the template switch pathway. The expression of PCNA protein are regulated by E2F transcriptor factor-containing complex.

There are no reviews yet.

Be the first to review “PCNA protein – Proliferating cell nuclear antigen”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products