Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human PSMA Protein: FOLH1 Recombinant Protein

Host species:
Insect
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q04609
Molecular weight:
87.36kDa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Partial No
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human PSMA Protein: FOLH1 Recombinant Protein

Product name Human PSMA Protein: FOLH1 Recombinant Protein
Uniprot ID Q04609
Uniprot link https://www.uniprot.org/uniprot/Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Molecular weight 87.36kDa
Protein delivered with Tag? No
Purity estimated 90% 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Partial
Protein Accession PDB: 2C6C_A
NCBI Reference 2OOT_A
Aliases /Synonyms Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase
Reference PX-P2059
Note For research use only
Molecular Constructor
Partial No
Product name Human PSMA Protein: FOLH1 Recombinant Protein
Uniprot ID Q04609
Uniprot link https://www.uniprot.org/uniprot/Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Molecular weight 87.36kDa
Protein delivered with Tag? No
Purity estimated 90% 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Partial
Protein Accession PDB: 2C6C_A
NCBI Reference 2OOT_A
Aliases /Synonyms Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase
Reference PX-P2059
Note For research use only
Molecular Constructor
Partial No
Product name PX-P2059-1MG
Uniprot ID Q04609
Uniprot link https://www.uniprot.org/uniprot/Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Molecular weight 87.36kDa
Protein delivered with Tag? No
Purity estimated 90% 80%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Partial
Protein Accession PDB: 2C6C_A
NCBI Reference 2OOT_A
Aliases /Synonyms Cell growth inhibiting protein 27, Cell growth-inhibiting gene 27 protein, FGCP, Folate hydrolase, Folate hydrolase (prostate-specific membrane antigen) 1, Folate hydrolase 1, Folate hydrolase prostate specific membrane antigen 1, FOLH, FOLH 1, Folh1, FOLH1_HUMAN, Folylpoly gamma glutamate carboxypeptidase, Folylpoly-gamma-glutamate carboxypeptidase, GCP 2, GCP II, GCP2, GCPII, GIG27, Glutamate carboxylase II, Glutamate carboxypeptidase 2, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N acetylated alpha linked acidic dipeptidase 1, N-acetylated-alpha-linked acidic dipeptidase I, NAALAD 1, NAALAD1, NAALAdase, NAALADase I, Prostate specific membrane antigen, Prostate specific membrane antigen variant F, Prostate-specific membrane antigen, PSM, PSMA, Pteroylpoly gamma glutamate carboxypeptidase, Pteroylpoly-gamma-glutamate carboxypeptidase
Reference PX-P2059
Note For research use only
Molecular Constructor
Partial No

Human PSMA Protein: FOLH1 Recombinant Protein

  • Barinka C, Starkova J, Konvalinka J, Lubkowski J. A high-resolution structure of ligand-free human glutamate carboxypeptidase II. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Mar 1;63(Pt 3):150-3. Epub 2007 Feb 13. PubMed PMID: 17329803; PubMed Central PMCID: PMC2330195.

There are no reviews yet.

Be the first to review “Human PSMA Protein: FOLH1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products