Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Huj591-Gsmab Biosimilar – Anti-FOLH1, PSMA mAb – Research Grade

Clonality:
Monoclonal Antibody

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Huj591-Gsmab Biosimilar - Anti-FOLH1, PSMA mAb - Research Grade

Product name Huj591-Gsmab Biosimilar - Anti-FOLH1, PSMA mAb - Research Grade
Uniprot ID Q04609
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Huj591-Gsmab,177 Lu-J591,HuJ591-GS,FOLH1, PSMA,anti-FOLH1, PSMA
Reference PX-TA1074
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name Huj591-Gsmab Biosimilar - Anti-FOLH1, PSMA mAb - Research Grade
Uniprot ID Q04609
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Huj591-Gsmab,177 Lu-J591,HuJ591-GS,FOLH1, PSMA,anti-FOLH1, PSMA
Reference PX-TA1074
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name PX-TA1074-50
Uniprot ID Q04609
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Huj591-Gsmab,177 Lu-J591,HuJ591-GS,FOLH1, PSMA,anti-FOLH1, PSMA
Reference PX-TA1074
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody

Introduction:

Huj591-Gsmab Biosimilar is a novel monoclonal antibody (mAb) that targets the prostate-specific membrane antigen (PSMA), also known as FOLH1. This biosimilar is a promising therapeutic option for the treatment of prostate cancer, as well as other PSMA-expressing malignancies. In this article, we will explore the structure, activity, and potential applications of Huj591-Gsmab Biosimilar in the field of cancer research.

Structure:

Huj591-Gsmab Biosimilar is a chimeric mAb, meaning it is composed of both human and mouse components. The antibody is composed of two heavy chains and two light chains, each with a variable region that specifically binds to PSMA. The constant regions of the antibody are derived from human IgG1, which provides stability and allows for interaction with immune cells. The variable regions, on the other hand, are derived from mouse IgG, which provides high affinity and specificity for PSMA.

Activity:

Huj591-Gsmab Biosimilar works by binding to the PSMA protein, which is highly expressed on the surface of prostate cancer cells. This binding triggers a series of events that ultimately leads to the destruction of the cancer cells. The antibody can also recruit immune cells, such as natural killer cells and macrophages, to attack the cancer cells. This mechanism of action makes Huj591-Gsmab Biosimilar a potent therapeutic agent for the treatment of PSMA-expressing cancers.

Application:

Huj591-Gsmab Biosimilar has shown promising results in preclinical studies for the treatment of prostate cancer. In a mouse model of prostate cancer, treatment with Huj591-Gsmab Biosimilar resulted in a significant reduction in tumor growth and prolonged survival. The biosimilar has also shown efficacy in combination with other standard treatments, such as chemotherapy and radiation therapy.

In addition to prostate

cancer, Huj591-Gsmab Biosimilar has potential applications in other PSMA-expressing malignancies, such as ovarian, bladder, and renal cell cancers. These cancers have limited treatment options and high mortality rates, making Huj591-Gsmab Biosimilar a valuable addition to the current treatment armamentarium.

Research Grade:

Huj591-Gsmab Biosimilar is currently in the research grade stage, meaning it is being studied in preclinical and early clinical trials. This stage is crucial for establishing the safety and efficacy of the biosimilar before it can be approved for use in patients. The biosimilar is being developed by a team of scientists and researchers who are dedicated to advancing cancer treatment options.

Conclusion:

In summary, Huj591-Gsmab Biosimilar is a promising therapeutic option for the treatment of PSMA-expressing cancers. Its unique structure and mechanism of action make it a potent and targeted treatment for prostate cancer and other malignancies. As it progresses through the research grade stage, Huj591-Gsmab Biosimilar has the potential to significantly improve patient outcomes and contribute to the fight against cancer.

SDS-PAGE for HuJ591-Gsmab Biosimilar - Anti-FOLH1;PSMA mAb - Research Grade

SDS-PAGE for HuJ591-Gsmab Biosimilar - Anti-FOLH1;PSMA mAb - Research Grade

HuJ591-Gsmab Biosimilar - Anti-FOLH1;PSMA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Huj591-Gsmab Biosimilar - Anti-FOLH1, PSMA mAb - Research Grade

There are no reviews yet.

Be the first to review “Huj591-Gsmab Biosimilar – Anti-FOLH1, PSMA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products