Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade

  • PX-TA1701-50
  • Validated FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Product name Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name PX-TA1701-50
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade

Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade: A Promising Antibody for Targeting FOLH1 Pelgifatamab Biosimilar, also known as Anti-FOLH1 mAb, is a research grade monoclonal antibody that has shown great potential in targeting FOLH1, a therapeutic target for various types of cancer. In this article, we will explore the structure, activity, and applications of this promising antibody in detail.

The Structure of Pelgifatamab Biosimilar

Pelgifatamab Biosimilar is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and belongs to the IgG1 subtype.

The specific binding site of Pelgifatamab Biosimilar is located on the variable region of the heavy chain, which recognizes and binds to FOLH1 with high specificity. This binding site is crucial for the antibody’s activity and makes it a potent therapeutic agent for targeting FOLH1-expressing cancer cells.

The Activity of Pelgifatamab Biosimilar

Pelgifatamab Biosimilar has been shown to exhibit strong anti-tumor activity in preclinical studies. It works by binding to FOLH1, a transmembrane protein that is highly expressed on the surface of various cancer cells, including prostate, lung, and breast cancer. This binding leads to the internalization of the antibody-antigen complex, resulting in the destruction of cancer cells through various mechanisms such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

In addition to its direct anti-tumor effects, Pelgifatamab Biosimilar has also been shown to enhance the activity of other cancer therapies, such as chemotherapy and radiation, when used in combination. This makes it a promising candidate for combination therapy in the treatment of cancer.

Applications of Pelgifatamab Biosimilar

The potential applications of Pelgifatamab Biosimilar are vast, given its strong anti-tumor activity and ability to enhance the effects of other cancer treatments. Some of the key applications of this antibody include:

  • Treatment of FOLH1-expressing cancers: Pelgifatamab Biosimilar has shown promising results in preclinical studies for the treatment of prostate, lung, and breast cancer, which are known to overexpress FOLH1.
  • Combination therapy: As mentioned earlier, Pelgifatamab Biosimilar has the potential to enhance the effects of other cancer therapies, making it a valuable addition to combination treatment regimens.
  • Research tool: The research grade of Pelgifatamab Biosimilar makes it an ideal tool for studying the role of FOLH1 in cancer development and progression. It can also be used in diagnostic tests to detect FOLH1 expression in cancer cells.

Conclusion

Pelgifatamab Biosimilar, also known as Anti-FOLH1 mAb, is a research grade monoclonal antibody that has shown great potential in targeting FOLH1, a therapeutic target for various types of cancer. Its unique structure and strong anti-tumor activity make it a promising candidate for the treatment of FOLH1-expressing cancers. With its potential to enhance the effects of other cancer therapies, Pelgifatamab Biosimilar holds great promise in improving cancer treatment outcomes. Further clinical studies are needed to fully explore the potential of this antibody in the fight against cancer.

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow-cytometry using PE anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1701, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow-cytometry using FITC anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1701, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products