Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15116
Molecular weight:
20.04kDa

Original price was: €300.00.Current price is: €259.00.

50ug 14% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Product name Human Programmed cell death protein 1 recombinant protein (PDCD1)
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
Molecular weight 20.04kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 150 mM NaCl, 50 mM Tris-HCl, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms pYNW1, CD279, PD1, SLEB2, HPD1
Reference PX-P4028
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Programmed cell death protein 1 recombinant protein (PDCD1)
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
Molecular weight 20.04kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 150 mM NaCl, 50 mM Tris-HCl, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms pYNW1, CD279, PD1, SLEB2, HPD1
Reference PX-P4028
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4028-1MG
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
Molecular weight 20.04kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 150 mM NaCl, 50 mM Tris-HCl, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms pYNW1, CD279, PD1, SLEB2, HPD1
Reference PX-P4028
Note For research use only
Molecular Constructor
Partial Yes

Human Programmed cell death protein 1 recombinant protein (PDCD1)

There are no reviews yet.

Be the first to review “Human Programmed cell death protein 1 recombinant protein (PDCD1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products