Brand: ProteoGenix

Human Programmed cell death protein 1 recombinant protein (PDCD1)

PX-P4028-10
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q15116
Molecular weight:: 20.04kDa

€210.00

+ 210 loyalty points

Partial Yes

size size

50ug €210.00
100ug €420.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Product name	Human Programmed cell death protein 1 recombinant protein (PDCD1)
Uniprot ID	Q15116
Uniprot link	http://www.uniprot.org/uniprot/Q15116
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
Molecular weight	20.04kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	150 mM NaCl, 50 mM Tris-HCl, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	pYNW1, CD279, PD1, SLEB2, HPD1
Reference	PX-P4028
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human Programmed cell death protein 1 recombinant protein (PDCD1)
Uniprot ID	Q15116
Uniprot link	http://www.uniprot.org/uniprot/Q15116
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVGSHHHHHH
Molecular weight	20.04kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	150 mM NaCl, 50 mM Tris-HCl, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	pYNW1, CD279, PD1, SLEB2, HPD1
Reference	PX-P4028
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human Programmed cell death protein 1 recombinant protein (PDCD1)”

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Related products

Pidilizumab Biosimilar – Anti-PDCD1, CD279 mAb – Research Grade

Camrelizumab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Gilvetmab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Tislelizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Budigalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cemiplimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Dostarlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Sintilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Toripalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Balstilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Lodapolimab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

CD121a Recombinant Protein

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Programmed cell death protein 1 recombinant protein (PDCD1)

Specifications Human Programmed cell death protein 1 recombinant protein (PDCD1)

Documents

Reviews

Related products

Pidilizumab Biosimilar – Anti-PDCD1, CD279 mAb – Research Grade

Camrelizumab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

Gilvetmab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Tislelizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Budigalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Cemiplimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Dostarlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Sintilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Toripalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Balstilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

Lodapolimab Biosimilar – Anti-PDCD1, PD-1, CD279 mAb – Research Grade

CD121a Recombinant Protein

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human Programmed cell death protein 1 recombinant protein (PDCD1)