Brand: ProteoGenix

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Host species:: Mammalian cells
Origin species:: Dog
Uniprot ID:: E2RKZ5
Molecular weight:: 25.94 kDa

Original price was: €479.00.Current price is: €420.00.

100ug 12% OFF + 420 loyalty points

Partial

Size Size

50ug Original price was: €235.00.Current price is: €210.00.
100ug Original price was: €479.00.Current price is: €420.00.
200ug Original price was: €2,158.00.Current price is: €1,798.00.
1MG Original price was: €1,559.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Product name	Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID	E2RKZ5
Uniprot link	http://www.uniprot.org/uniprot/E2RKZ5
Origin species	Dog
Expression system	Eukaryotic expression
Raw Antigen Sequence	MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight	25.94 kDa
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
NCBI Reference	E2RKZ5
Biological activity	Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms	CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference	PX-P3014
Note	For research use only
Molecular Constructor	Partial

Product name	Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID	E2RKZ5
Uniprot link	http://www.uniprot.org/uniprot/E2RKZ5
Origin species	Dog
Expression system	Eukaryotic expression
Raw Antigen Sequence	MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight	25.94 kDa
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
NCBI Reference	E2RKZ5
Biological activity	Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms	CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference	PX-P3014
Note	For research use only
Molecular Constructor	Partial

Product name	Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID	E2RKZ5
Uniprot link	http://www.uniprot.org/uniprot/E2RKZ5
Origin species	Dog
Expression system	Eukaryotic expression
Raw Antigen Sequence	MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight	25.94 kDa
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
NCBI Reference	E2RKZ5
Biological activity	Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms	CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference	PX-P3014
Note	For research use only
Molecular Constructor	Partial

Product name	PX-P3014-1MG
Uniprot ID	E2RKZ5
Uniprot link	http://www.uniprot.org/uniprot/E2RKZ5
Origin species	Dog
Expression system	Eukaryotic expression
Raw Antigen Sequence	MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight	25.94 kDa
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
NCBI Reference	E2RKZ5
Biological activity	Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms	CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference	PX-P3014
Note	For research use only
Molecular Constructor	Partial

General information on Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis.

Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075.

There are no reviews yet.

Be the first to review “Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein”