Brand: ProteoGenix

Human Human DCLK3 partial (162-632) Recombinant Protein

PX-P2075-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q9C098
Molecular weight:: 54.83kDa

€210.00

50ug + 210 loyalty points

Partial Yes

size size

50ug €210.00
100ug €479.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human Human DCLK3 partial (162-632) Recombinant Protein

Product name	Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID	Q9C098
Uniprot link	http://www.uniprot.org/uniprot/Q9C098
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight	54.83kDa
Protein delivered with Tag?	Yes
Purity estimated	30%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	NP_208382.1
Spec:Entrez GeneID	85443
Spec:NCBI Gene Aliases	DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID	Q9C098
NCBI Reference	NP_208382.1
Aliases /Synonyms	Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference	PX-P2075
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID	Q9C098
Uniprot link	http://www.uniprot.org/uniprot/Q9C098
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight	54.83kDa
Protein delivered with Tag?	Yes
Purity estimated	30%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	NP_208382.1
Spec:Entrez GeneID	85443
Spec:NCBI Gene Aliases	DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID	Q9C098
NCBI Reference	NP_208382.1
Aliases /Synonyms	Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference	PX-P2075
Note	For research use only
Molecular Constructor	Partial Yes