Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Human DCLK3 partial (162-632) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9C098
Molecular weight:
54.83kDa

Original price was: €303.00.Current price is: €259.00.

50ug 15% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Human DCLK3 partial (162-632) Recombinant Protein

Product name Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P2075-1MG
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes

Human Human DCLK3 partial (162-632) Recombinant Protein

There are no reviews yet.

Be the first to review “Human Human DCLK3 partial (162-632) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products