Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade

  • PX-TA1011-50
  • Validated ELISA
Isotype:
IgG1

Original price was: €111.00.Current price is: €84.00.

50ug 24% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name PX-TA1011-50
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

General information about Ustekinumab

Ustekinumab is a human monoclonal antibody used to treat psoriasis. It is also approved to treat Crohn’s disease and ulcerative colitis among people who have not responded to more traditional treatments. It is a subcutaneous human interleukin 12 and interleukin 23 antagonist. These are naturally occurring proteins that regulate the immune system and immune-mediated inflammatory disorders. This product is for research use only.

SDS-PAGE for Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb

SDS-PAGE for Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

SEC-HPLC of Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products