Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humax-Il15 Biosimilar – Anti-IL15 mAb – Research Grade

  • PX-TA1131-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade

Product name Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade
Uniprot ID P40933
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade
Uniprot ID P40933
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1131-50
Uniprot ID P40933
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Humax-Il15,AMG 714,HuMax-IL15,IL15,anti-IL15
Reference PX-TA1131
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Humax-Il15 Biosimilar is a novel therapeutic antibody that targets the cytokine interleukin-15 (IL-15). This biosimilar is a research grade version of the anti-IL15 monoclonal antibody (mAb) Humax-Il15, which has shown promising results in preclinical studies for the treatment of various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and potential applications of Humax-Il15 Biosimilar in detail.

Structure of Humax-Il15 Biosimilar

Humax-Il15 Biosimilar is a recombinant, fully humanized mAb that is produced using state-of-the-art genetic engineering techniques. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) at the tips of the arms and a crystallizable fragment (Fc) at the base.

The variable regions of the heavy and light chains are responsible for binding to IL-15, while the Fc region is involved in effector functions such as complement activation and antibody-dependent cell-mediated cytotoxicity (ADCC). The constant regions of the heavy and light chains are highly homologous to human IgG1, ensuring a low immunogenicity profile.

Activity of Humax-Il15 Biosimilar

IL-15 is a pro-inflammatory cytokine that plays a critical role in the development and maintenance of various immune cells, including natural killer (NK) cells, T cells, and B cells. It is also involved in the pathogenesis of several autoimmune and inflammatory diseases, making it an attractive therapeutic target.

Humax-Il15 Biosimilar binds to IL-15 with high affinity and specificity, preventing it from binding to its receptor and exerting its pro-inflammatory effects. This leads to a reduction in the activation and proliferation of immune cells, thereby suppressing the inflammatory response. Additionally, the Fc region of the antibody can also activate immune cells to destroy IL-15-expressing cells through ADCC, providing an additional mechanism of action.

Potential Applications of Humax-Il15 Biosimilar

Humax-Il15 Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease. By blocking IL-15, it can reduce the activation and proliferation of immune cells, leading to a decrease in inflammation and tissue damage.

In addition, Humax-Il15 Biosimilar has also shown potential as an immunosuppressive agent in transplantation. IL-15 is known to play a role in organ rejection, and by inhibiting its activity, Humax-Il15 Biosimilar could potentially improve transplant outcomes.

Furthermore, IL-15 has been implicated in the pathogenesis of certain types of cancer, such as leukemia and lymphoma. By targeting IL-15, Humax-Il15 Biosimilar could potentially be used as a treatment for these malignancies.

Conclusion

In summary, Humax-Il15 Biosimilar is a novel therapeutic antibody that targets the pro-inflammatory cytokine IL-15. Its unique structure and mechanism of action make it a promising candidate for the treatment of various inflammatory and autoimmune diseases, as well as in transplantation and cancer. Further clinical trials will be needed to fully evaluate the efficacy and safety of this biosimilar, but it holds great potential in improving the lives of patients with these conditions.

SEC-HPLC of HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

SEC-HPLC of HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

SDS-PAGE for HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade

HuMax-IL15 Biosimilar - Anti-IL15 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humax-Il15 Biosimilar - Anti-IL15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Humax-Il15 Biosimilar – Anti-IL15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products