Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gatralimab Biosimilar – Anti-CD52 mAb – Research Grade

  • PX-TA1589-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

Product name Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1589-50
Uniprot ID P31358
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Gatralimab Biosimilar: A Promising Antibody Targeting CD52

Gatralimab Biosimilar, also known as Anti-CD52 mAb, is a novel therapeutic antibody that has shown promising results in the treatment of various diseases. This research grade antibody is designed to specifically target CD52, a protein found on the surface of immune cells. In this article, we will discuss the structure, activity, and potential applications of Gatralimab Biosimilar.

Structure of Gatralimab Biosimilar

Gatralimab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of cells. It belongs to the IgG class of antibodies and has a molecular weight of approximately 150 kDa. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL).

The variable domains of Gatralimab Biosimilar are responsible for its specificity towards CD52. These domains contain a unique sequence of amino acids that can bind to CD52 with high affinity and specificity. The constant domains, on the other hand, are responsible for the effector functions of the antibody, such as binding to immune cells and triggering immune responses.

Activity of Gatralimab Biosimilar

The main activity of Gatralimab Biosimilar is the targeting of CD52-positive cells. CD52 is a glycoprotein that is expressed on the surface of various immune cells, including T and B lymphocytes, natural killer cells, and monocytes. By binding to CD52, Gatralimab Biosimilar can effectively deplete these cells, leading to a decrease in immune responses.

In addition to CD52 targeting, Gatralimab Biosimilar also has other effector functions that contribute to its therapeutic activity. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). In ADCC, the antibody binds to immune cells, such as natural killer cells, which then release toxic substances to kill the target cells. In CDC, the antibody activates the complement system, which also leads to the destruction of target cells.

Potential Applications of Gatralimab Biosimilar

Gatralimab Biosimilar has shown promising results in the treatment of various diseases, particularly those involving dysregulated immune responses. One of the main applications of this antibody is in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. By depleting CD52-positive immune cells, Gatralimab Biosimilar can help reduce inflammation and improve symptoms in these conditions.

Another potential application of Gatralimab Biosimilar is in the treatment of certain types of cancer. CD52 is overexpressed on the surface of some cancer cells, making them potential targets for this antibody. By targeting and depleting these cancer cells, Gatralimab Biosimilar can potentially inhibit tumor growth and improve patient outcomes.

Gatralimab Biosimilar is also being investigated for its use in organ transplantation. CD52 is highly expressed on the surface of T and B lymphocytes, which play a crucial role in transplant rejection. By depleting these cells, Gatralimab Biosimilar can help prevent rejection and improve the success of organ transplantation.

Conclusion

Gatralimab Biosimilar is a novel therapeutic antibody that specifically targets CD52, a protein found on the surface of immune cells. Its unique structure and effector functions make it a promising candidate for the treatment of various diseases, including autoimmune diseases, cancer, and organ transplantation. Further research and clinical trials are needed to fully understand the potential of Gatralimab Biosimilar and its role in improving patient outcomes.

SDS-PAGE for Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

SDS-PAGE for Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

Flow Cytometry results for Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

Flow-cytometry APC using anti-human CD52 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an APC anti-human CD52 monoclonal antibody (Catalog PX-TA1589) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gatralimab Biosimilar – Anti-CD52 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

  • CD52 Recombinant Protein
    Original price was: €268.00.Current price is: €223.00.
    View Product

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products