Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Izuralimab Biosimilar – Anti-ICOS;PDCD1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade

Product name Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody
Product name Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody
Product name PX-TA1675-50
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody

Introduction to Izuralimab Biosimilar – Anti-ICOS,PDCD1 mAb – Research Grade

Izuralimab Biosimilar, also known as Anti-ICOS,PDCD1 mAb, is a monoclonal antibody that has been developed as a biosimilar to the existing therapeutic antibody, pembrolizumab. This biosimilar is designed to target two important immune checkpoint proteins, ICOS and PDCD1, and has shown promising results in preclinical studies. In this article, we will explore the structure, activity, and potential applications of Izuralimab Biosimilar.

Structure of Izuralimab Biosimilar

Izuralimab Biosimilar is a fully humanized monoclonal antibody, meaning that it is derived from human cells and has a high affinity for its target proteins. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. It is a member of the immunoglobulin G (IgG) class, which is the most abundant type of antibody in the human body.

Activity of Izuralimab Biosimilar

The primary mechanism of action of Izuralimab Biosimilar is through its binding to the immune checkpoint proteins, ICOS and PDCD1. These proteins are present on the surface of T cells and play a critical role in regulating the immune response. ICOS is a co-stimulatory molecule that promotes T cell activation and proliferation, while PDCD1, also known as PD-1, is an inhibitory molecule that suppresses T cell activity.

By targeting both ICOS and PDCD1, Izuralimab Biosimilar is able to modulate the immune response in a more comprehensive manner compared to targeting either protein alone. This dual mechanism of action has the potential to enhance the anti-tumor activity of the antibody and improve patient outcomes.

Applications of Izuralimab Biosimilar

Izuralimab Biosimilar is being developed as a potential treatment for various types of cancer, including melanoma, non-small cell lung cancer, and bladder cancer. These cancers are known to have high expression of ICOS and PDCD1, making them ideal targets for this antibody.

In preclinical studies, Izuralimab Biosimilar has demonstrated potent anti-tumor activity, both as a single agent and in combination with other cancer therapies. It has also shown a favorable safety profile, with minimal side effects observed in animal models. These promising results have led to the initiation of clinical trials to evaluate the safety and efficacy of Izuralimab Biosimilar in human patients.

Conclusion

In summary, Izuralimab Biosimilar is a novel monoclonal antibody that targets the immune checkpoint proteins ICOS and PDCD1. Its dual mechanism of action has the potential to enhance the anti-tumor activity of the antibody and improve patient outcomes. With ongoing clinical trials, Izuralimab Biosimilar has the potential to become a valuable addition to the arsenal of cancer therapies, providing a promising new treatment option for patients in need.

Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Izuralimab Biosimilar – Anti-ICOS;PDCD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products