Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Olokizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Olokizumab ELISA Kit

Olokizumab ELISA Kit

Product name Olokizumab ELISA Kit
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX150
Note For research use only.
Sample type Plasma, Serum
Target Olokizumab
Immunogen Olokizumab

Introduction

Olokizumab is a humanized monoclonal antibody that specifically targets the interleukin-6 (IL-6) cytokine. It has been developed as a potential therapeutic agent for inflammatory diseases, particularly rheumatoid arthritis (RA). In order to study the levels of olokizumab in biological samples, an enzyme-linked immunosorbent assay (ELISA) kit has been developed. In this article, we will discuss the structure, activity and application of the Olokizumab ELISA Kit.

Structure of Olokizumab

Olokizumab is a recombinant humanized IgG4 monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains have only a variable region. The variable regions are responsible for binding to the IL-6 cytokine. Olokizumab has a molecular weight of approximately 148 kDa and a half-life of 21 days.

Activity of Olokizumab

Olokizumab binds to the IL-6 cytokine with high affinity and specificity, preventing its interaction with the IL-6 receptor and subsequent downstream signaling. This inhibits the pro-inflammatory effects of IL-6, such as the activation of immune cells and the production of other inflammatory cytokines. Olokizumab has been shown to effectively reduce the symptoms and progression of RA in clinical trials.

Application of Olokizumab ELISA Kit

The Olokizumab ELISA Kit is a quantitative assay that is used to measure the levels of olokizumab in biological samples, such as serum, plasma, and synovial fluid. This kit utilizes a sandwich ELISA method, where the olokizumab in the sample is captured by an immobilized anti-human IgG antibody and then detected by a biotinylated anti-human IL-6 antibody. The amount of olokizumab present in the sample is directly proportional to the color intensity, which can be measured spectrophotometrically.

Advantages of Olokizumab ELISA Kit

The Olokizumab ELISA Kit has several advantages over other methods of olokizumab detection. Firstly, it is a highly sensitive and specific assay, with a detection limit of 0.1 ng/mL. This allows for accurate measurement of low levels of olokizumab in biological samples. Secondly, the kit is easy to use and can be performed in a relatively short amount of time. This makes it a convenient tool for researchers and clinicians. Lastly, the Olokizumab ELISA Kit has been validated for use with multiple sample types, making it a versatile assay for different research purposes.

Clinical Applications

The Olokizumab ELISA Kit has been used in various clinical studies to measure the levels of olokizumab in patients with RA. It has been shown to effectively monitor the pharmacokinetics of olokizumab, as well as assess its efficacy in reducing RA symptoms. In addition, the kit has also been used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of olokizumab in animal models.

Conclusion

The Olokizumab ELISA Kit is a valuable tool for studying the levels of olokizumab in biological samples. Its high sensitivity, specificity, and ease of use make it a preferred method for researchers and clinicians. With the promising results of olokizumab in clinical trials, the Olokizumab ELISA Kit will continue to play an important role in the development and evaluation of this potential therapeutic agent for inflammatory diseases.

Olokizumab ELISA Kit

There are no reviews yet.

Be the first to review “Olokizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products