Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Duvakitug Biosimilar – Anti-TNFSF15 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €181.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade

Product name Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1942-50
Uniprot ID O95150
Source CAS: 2750005-84-4
Species Human
Expression system XtenCHO
Raw Antigen Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-TNFSF15, Vascular endothelial cell growth inhibitor, VEGI, TL1, TNF ligand-related molecule 1, Tumor necrosis factor ligand superfamily member 15
Reference PX-TA1942
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Duvakitug Biosimilar is a novel antibody-based therapeutic agent targeting TNFSF15, a cytokine involved in inflammatory processes. This biosimilar is a research grade version of an existing anti-TNFSF15 monoclonal antibody, with similar structure and activity. In this article, we will discuss the structure, activity, and potential applications of Duvakitug Biosimilar in the field of immunology and inflammatory diseases.

Structure of Duvakitug Biosimilar

Duvakitug Biosimilar is a monoclonal antibody, meaning it is a highly specific protein that binds to a single target. It is composed of two identical heavy chains and two identical light chains, each with a unique amino acid sequence. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions of both chains are responsible for binding to TNFSF15, while the constant regions provide stability and effector functions.

Activity of Duvakitug Biosimilar

Duvakitug Biosimilar works by binding to TNFSF15, a cytokine that plays a crucial role in the regulation of inflammation. TNFSF15 is primarily produced by activated immune cells and has been implicated in various inflammatory diseases, including inflammatory bowel disease, rheumatoid arthritis, and psoriasis. By binding to TNFSF15, Duvakitug Biosimilar prevents it from interacting with its receptor, TNFRSF15, and initiating downstream inflammatory signaling pathways.

Additionally, Duvakitug Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms involve the recruitment of immune cells and the activation of the complement system, respectively, to eliminate cells expressing TNFSF15. This dual mechanism of action makes Duvakitug Biosimilar a potent therapeutic agent for targeting TNFSF15.

Applications of Duvakitug Biosimilar

Duvakitug Biosimilar has the potential to be used in the treatment of various inflammatory diseases. Preclinical studies have shown promising results in animal models of inflammatory bowel disease, rheumatoid arthritis, and psoriasis. In these models, Duvakitug Biosimilar was able to reduce inflammation and improve disease symptoms.

Moreover, Duvakitug Biosimilar can also be used as a research tool to study the role of TNFSF15 in different inflammatory conditions. By blocking TNFSF15, researchers can better understand its function and potential as a therapeutic target. This biosimilar can also be used in diagnostic assays to detect TNFSF15 levels in patient samples.

Conclusion

Duvakitug Biosimilar is a novel antibody-based therapeutic agent targeting TNFSF15, a cytokine involved in inflammatory processes. Its structure, activity, and potential applications make it a promising candidate for the treatment of various inflammatory diseases. As a research grade version of an existing anti-TNFSF15 monoclonal antibody, Duvakitug Biosimilar provides a valuable tool for studying the role of TNFSF15 in inflammatory conditions. Further clinical studies are needed to fully evaluate the efficacy and safety of Duvakitug Biosimilar in human patients.

SDS-PAGE for Research Grade Duvakitug

SDS-PAGE for Research Grade Duvakitug

Research Grade Duvakitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Duvakitug Biosimilar - Anti-TNFSF15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Duvakitug Biosimilar – Anti-TNFSF15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products