Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Donzakimig Biosimilar – Anti-Interleukin-22; Albumin mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1(VH-CH1-h)-scFv_L-kappa-scFv

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade

Product name PX-TA2114-50
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody
Product name Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody
Product name Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade
Uniprot ID Q9GZX6 & P35225 & P02768
Source CAS: 2765066-99-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2114
Note For research use only. Not suitable for human use.
Isotype IgG1(VH-CH1-h)-scFv_L-kappa-scFv
Clonality Monoclonal Antibody

Introduction

Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade is a novel therapeutic antibody that has been developed as a biosimilar of the existing drug, Donzakimig. This biosimilar is designed to target the cytokine Interleukin-22 (IL-22), which has been implicated in various inflammatory and autoimmune diseases. Donzakimig Biosimilar is a monoclonal antibody (mAb) that specifically binds to IL-22 and inhibits its activity, making it a promising candidate for the treatment of IL-22 mediated diseases. In this article, we will provide a scientific description of Donzakimig Biosimilar, including its structure, activity, and potential applications.

Structure of Donzakimig Biosimilar

Donzakimig Biosimilar is a recombinant humanized monoclonal antibody, which means it is produced in the laboratory by genetically engineering human genes into a non-human host, typically Chinese hamster ovary (CHO) cells. The antibody consists of two heavy chains and two light chains, each with a unique amino acid sequence. The heavy chains are approximately 50 kDa in size and contain a variable region, responsible for binding to IL-22, and a constant region, which determines the antibody’s class and function. The light chains are approximately 25 kDa in size and also have a variable and constant region. The variable regions of both the heavy and light chains come together to form the antigen-binding site, which is specific for IL-22.

Activity of Donzakimig Biosimilar

IL-22 is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases, including psoriasis, rheumatoid arthritis, and inflammatory bowel disease. It exerts its effects by binding to its receptor, IL-22R, which is expressed on the surface of various cells, including epithelial cells, fibroblasts, and immune cells. Donzakimig Biosimilar specifically binds to IL-22, preventing it from binding to its receptor and inhibiting its activity. This leads to a decrease in the production of pro-inflammatory cytokines and chemokines, ultimately reducing inflammation and tissue damage.

Applications of Donzakimig Biosimilar

Donzakimig Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various IL-22 mediated diseases. The most advanced indication for this biosimilar is psoriasis, a chronic inflammatory skin disease characterized by red, scaly patches on the skin. In a phase II clinical trial, Donzakimig Biosimilar showed significant improvement in psoriasis symptoms, including skin lesions and itching, compared to placebo. It also demonstrated a favorable safety profile with no serious adverse events reported.

Apart from psoriasis, Donzakimig Biosimilar has also shown potential in other diseases, such as rheumatoid arthritis and inflammatory bowel disease. In a preclinical study, it was found to reduce joint inflammation and destruction in a mouse model of rheumatoid arthritis. In another study, Donzakimig Biosimilar was able to ameliorate colitis symptoms and reduce intestinal inflammation in a mouse model of inflammatory bowel disease. These findings suggest that Donzakimig Biosimilar may have a broad range of therapeutic applications in various IL-22 mediated diseases.

Conclusion

Donzakimig Biosimilar – Anti-Interleukin-22, Albumin mAb – Research Grade is a promising therapeutic antibody that specifically targets IL-22, a cytokine involved in various inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a potential treatment option for diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. With ongoing clinical trials, Donzakimig Biosimilar has the potential to provide a safe and effective treatment for patients suffering from IL-22 mediated diseases.

SDS-PAGE for Research Grade Donzakimig

SDS-PAGE for Research Grade Donzakimig

Research Grade Donzakimig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Research Grade Donzakimig

SDS-PAGE for Research Grade Donzakimig

Research Grade Donzakimig, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Donzakimig Biosimilar - Anti-Interleukin-22; Albumin mAb - Research Grade

There are no reviews yet.

Be the first to review “Donzakimig Biosimilar – Anti-Interleukin-22; Albumin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products