Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fanastomig Biosimilar – Anti-FDC; CD279 mAb – Research Grade

  • PX-TA2118-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade

Product name PX-TA2118-50
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody
Product name Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody
Product name Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody

Fanastomig Biosimilar: A Novel Anti-FDC, CD279 mAb for Research Introduction

Fanastomig Biosimilar, also known as Anti-FDC, CD279 mAb, is a novel monoclonal antibody (mAb) that has been developed as a potential therapeutic agent for various diseases. This biosimilar is a highly specific and potent antibody that targets the follicular dendritic cells (FDCs) and CD279, also known as programmed cell death protein 1 (PD-1). In this article, we will discuss the structure, activity, and potential applications of Fanastomig Biosimilar as a research-grade antibody.

Structure of Fanastomig Biosimilar

Fanastomig Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been developed using advanced genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of Fanastomig Biosimilar is specifically designed to bind to FDCs and CD279, while the constant region is responsible for effector functions such as complement activation and antibody-dependent cell-mediated cytotoxicity (ADCC).

The amino acid sequence of Fanastomig Biosimilar has been carefully engineered to ensure high specificity and minimal immunogenicity. It has a molecular weight of approximately 150 kDa and a half-life of around 21 days, making it a stable and long-lasting antibody.

Mechanism of Action

Fanastomig Biosimilar exerts its therapeutic effects by binding to FDCs and CD279 on the surface of immune cells. FDCs are specialized cells found in lymphoid tissues that play a critical role in the activation and regulation of the immune response. CD279, on the other hand, is a co-inhibitory receptor that is expressed on activated T cells and plays a key role in immune tolerance.

By targeting FDCs, Fanastomig Biosimilar can disrupt the formation of germinal centers, which are essential for the development of B cell-mediated immune responses. This can be beneficial in diseases where abnormal B cell activation and proliferation contribute to disease progression, such as autoimmune disorders and certain types of cancer.

Furthermore, by binding to CD279, Fanastomig Biosimilar can block the inhibitory signal that is normally transmitted to T cells, thereby enhancing their activity and promoting an anti-tumor immune response. This mechanism of action makes Fanastomig Biosimilar a promising therapeutic agent for cancer immunotherapy.

Potential Applications of Fanastomig Biosimilar

Fanastomig Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various diseases. Some potential applications of this biosimilar include:

  • Autoimmune disorders: Fanastomig Biosimilar has the potential to treat autoimmune diseases such as rheumatoid arthritis, lupus, and multiple sclerosis by targeting FDCs and disrupting the formation of germinal centers.
  • Cancer immunotherapy: By targeting CD279, Fanastomig Biosimilar can enhance the activity of T cells and promote an anti-tumor immune response. This makes it a promising candidate for cancer immunotherapy.
  • Infectious diseases: FDCs play a crucial role in the immune response against viral infections. By targeting FDCs, Fanastomig Biosimilar has the potential to modulate the immune response and improve outcomes in viral infections.

Conclusion

Fanastomig Biosimilar is a novel monoclonal antibody that targets FDCs and CD279, making it a promising therapeutic agent for various diseases. Its unique mechanism

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fanastomig Biosimilar – Anti-FDC; CD279 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products