Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cusatuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Cusatuzumab ELISA Kit

Cusatuzumab ELISA Kit

Product name Cusatuzumab ELISA Kit
Uniprot ID P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX221
Note For research use only.
Sample type Plasma, Serum
Target Cusatuzumab
Immunogen Cusatuzumab

The Structure of Cusatuzumab ELISA Kit

Cusatuzumab ELISA Kit is a highly specific and sensitive enzyme-linked immunosorbent assay (ELISA) kit designed for the detection and quantification of Cusatuzumab in biological samples. Cusatuzumab, also known as ARGX-110, is a humanized monoclonal antibody that targets the CD70 protein, which is overexpressed in various types of cancer cells.

The Cusatuzumab ELISA Kit is composed of several components, including microtiter plates coated with a specific anti-Cusatuzumab antibody, a detection antibody conjugated with an enzyme, and a substrate solution. The microtiter plate is pre-coated with the anti-Cusatuzumab antibody, which specifically binds to Cusatuzumab present in the sample. The detection antibody, which is conjugated with an enzyme, binds to the captured Cusatuzumab, forming a sandwich complex. The enzyme converts the substrate solution into a detectable signal, which is then measured using a spectrophotometer.

The Activity of Cusatuzumab ELISA Kit

The Cusatuzumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Cusatuzumab in biological samples. The kit has a limit of detection (LOD) of 0.1 ng/mL, making it suitable for detecting low levels of Cusatuzumab in patient samples. The assay has a wide dynamic range of 0.2-10 ng/mL, allowing for the accurate measurement of Cusatuzumab concentrations in both high and low levels.

The activity of the Cusatuzumab ELISA Kit is based on the principle of sandwich ELISA, which is a widely used technique for the quantification of specific proteins in biological samples. The kit utilizes a highly specific anti-Cusatuzumab antibody for capturing Cusatuzumab in the sample, and a detection antibody conjugated with an enzyme for signal amplification. This results in a highly sensitive and specific assay for the detection of Cusatuzumab.

The Application of Cusatuzumab ELISA Kit

Cusatuzumab ELISA Kit has various applications in the field of cancer research and drug development. The kit can be used to measure the levels of Cusatuzumab in patient samples, providing valuable information for the monitoring of Cusatuzumab therapy. It can also be used to assess the pharmacokinetics and pharmacodynamics of Cusatuzumab, which are essential for understanding its efficacy and safety in clinical trials.

Moreover, the Cusatuzumab ELISA Kit can also be used for the screening of potential therapeutic targets for Cusatuzumab in various cancer types. As CD70 is overexpressed in many cancers, this ELISA kit can aid in the identification of CD70-positive tumors, which can potentially benefit from Cusatuzumab therapy.

In addition, the Cusatuzumab ELISA Kit can also be used in the development and quality control of Cusatuzumab-based therapeutics. The accurate quantification of Cusatuzumab levels in different formulations and batches is crucial for ensuring the consistency and efficacy of the drug.

Conclusion

In summary, the Cusatuzumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Cusatuzumab in biological samples. Its unique structure and activity make it a valuable tool for cancer research and drug development, with various applications in the monitoring of Cusatuzumab therapy, identification of potential therapeutic targets, and quality control of Cusatuzumab-based therapeutics.

Cusatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Cusatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products