Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Certolizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Certolizumab ELISA Kit

Certolizumab ELISA Kit

Product name Certolizumab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX128
Note For research use only.
Sample type Plasma, Serum
Target Certolizumab
Immunogen Certolizumab

The Structure of Certolizumab ELISA Kit

Certolizumab ELISA Kit is a highly sensitive and specific immunoassay designed for the quantitative measurement of certolizumab in various biological samples. The kit is based on the principle of enzyme-linked immunosorbent assay (ELISA), which utilizes the binding interaction between an antibody and its corresponding antigen.

The Certolizumab ELISA Kit contains all the necessary components for the detection of certolizumab, including precoated microplate, standards, controls, and detection reagents. The precoated microplate is coated with a monoclonal antibody that specifically recognizes certolizumab. This antibody is immobilized on the surface of the microplate, allowing for the capture of certolizumab present in the sample.

The Activity of Certolizumab ELISA Kit

The activity of Certolizumab ELISA Kit is based on the principle of competitive ELISA. In this assay, the certolizumab present in the sample competes with a certolizumab-horseradish peroxidase (HRP) conjugate for binding to the immobilized certolizumab antibody on the microplate. The amount of certolizumab present in the sample is inversely proportional to the signal generated by the HRP conjugate. This signal can be measured spectrophotometrically and is directly proportional to the amount of certolizumab present in the sample.

The Application of Certolizumab ELISA Kit

Certolizumab is a monoclonal antibody that specifically targets and inhibits tumor necrosis factor alpha (TNF-α), a pro-inflammatory cytokine involved in the pathogenesis of various autoimmune diseases, such as rheumatoid arthritis, Crohn’s disease, and psoriasis. Certolizumab is used as a therapeutic agent for the treatment of these diseases.

The Certolizumab ELISA Kit is a valuable tool for monitoring the levels of certolizumab in patients undergoing treatment with this therapeutic agent. It can be used to measure the concentration of certolizumab in serum, plasma, and other biological samples, providing important information on the drug’s pharmacokinetics and efficacy.

In addition, the Certolizumab ELISA Kit can also be used in research studies to investigate the pharmacodynamics of certolizumab and its mechanism of action. It can be used to determine the levels of certolizumab in animal models and in vitro cell culture systems, providing valuable insights into the drug’s activity and potential side effects.

Furthermore, the Certolizumab ELISA Kit can be used in clinical trials to evaluate the efficacy of certolizumab in different patient populations. It can be used to compare the levels of certolizumab in responders and non-responders, as well as to monitor the drug’s long-term effects on patients.

In conclusion, Certolizumab ELISA Kit is a highly sensitive and specific assay that provides accurate and reliable measurement of certolizumab levels in various biological samples. Its application in clinical and research settings makes it an essential tool for the evaluation and monitoring of certolizumab as a therapeutic agent.

Certolizumab ELISA Kit

There are no reviews yet.

Be the first to review “Certolizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products