Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Remtolumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Remtolumab ELISA Kit

Remtolumab ELISA Kit

Product name Remtolumab ELISA Kit
Uniprot ID Q16552 & P01375
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX260
Note For research use only.
Sample type Plasma, Serum
Target Remtolumab
Immunogen Remtolumab

Introduction to Remtolumab ELISA Kit

The Remtolumab ELISA Kit is a highly sensitive and specific assay designed for the detection and quantification of Remtolumab, a novel monoclonal antibody, in various biological samples. This kit is based on the principle of Enzyme-Linked Immunosorbent Assay (ELISA) and offers a reliable and accurate method for measuring Remtolumab levels in serum, plasma, and cell culture supernatants. The kit is designed to provide researchers and clinicians with a quick and easy way to assess Remtolumab levels, which can be used for monitoring therapy and evaluating the efficacy of this therapeutic antibody.

Structure of Remtolumab

Remtolumab is a fully humanized monoclonal antibody that specifically targets the programmed death-1 (PD-1) receptor. It is composed of two heavy chains and two light chains, and has a molecular weight of approximately 150 kDa. The antibody has a unique structure that allows it to bind to PD-1, a key immune checkpoint receptor that plays a critical role in regulating T-cell activation and immune response. Remtolumab has been shown to have a high binding affinity and selectivity for PD-1, making it a promising therapeutic agent for treating various cancers and autoimmune diseases.

Activity of Remtolumab

Remtolumab exerts its therapeutic activity by blocking the interaction between PD-1 and its ligands, PD-L1 and PD-L2. This interaction is known to inhibit T-cell function and promote tumor immune evasion. By binding to PD-1, Remtolumab prevents the inhibitory signals from PD-L1 and PD-L2, thereby restoring T-cell activity and promoting anti-tumor immune responses. In addition, Remtolumab has been shown to induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against PD-L1-expressing tumor cells, further enhancing its anti-tumor effects.

Application of Remtolumab ELISA Kit

The Remtolumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, it can be used to measure Remtolumab levels in various biological samples, such as serum, plasma, and cell culture supernatants. This allows researchers to monitor Remtolumab pharmacokinetics, evaluate its efficacy, and optimize dosing regimens. In addition, the kit can be used to screen for potential biomarkers that may predict response to Remtolumab therapy.

In clinical settings, the Remtolumab ELISA Kit can be used for therapeutic drug monitoring, which involves measuring drug levels in patient samples to ensure that they are within the desired therapeutic range. This can help clinicians to adjust dosing regimens and optimize treatment outcomes. Furthermore, the kit can be used for pharmacokinetic studies, which are essential for understanding the absorption, distribution, metabolism, and excretion of Remtolumab in patients.

Conclusion

The Remtolumab ELISA Kit is a valuable tool for assessing Remtolumab levels in various biological samples. Its high sensitivity and specificity make it a reliable method for monitoring Remtolumab therapy and evaluating its efficacy. With its wide range of applications, this kit has the potential to facilitate research and improve patient care in the field of immunotherapy. As Remtolumab continues to show promising results in clinical trials, the demand for this ELISA kit is expected to increase, making it an essential tool for researchers and clinicians alike.

Remtolumab ELISA Kit

There are no reviews yet.

Be the first to review “Remtolumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products