Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD66e Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P06731
Molecular weight:
130kDa

€319.00

100ug + 319 loyalty points
Met1~Ala685 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay
Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay
Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay
Cergutuzumab Biosimilar - Anti-CEACAM5, CEA, CD66e mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

CD66e Recombinant Protein

Product name CD66e Recombinant Protein
Uniprot ID P06731
Uniprot link http://www.uniprot.org/uniprot/P06731
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Molecular weight 130kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ala685
Aliases /Synonyms CEA
Reference PX-P4089
Note For research use only.
Molecular Constructor
Met1~Ala685 His

General information on CD66e Recombinant Protein:

Carcinoembryonic antigen related cell adhesion molecule 5 (CEACAM5) is also carcinoembryonic antigen (CEA), meconium antigen 100, CD antigen CD66e, CEACAM5 belongs to the immunoglobulin superfamily and CEA family. CEACAM5 contains seven Ig-like (immunoglobulin-like) domains. CEACAM5/CD66e is a homodimeric protein and its binding to E. coli Dr adhesin results in the dispersion of homodimers. CEACAM5 is a cell surface glycoprotein that plays a role in cell adhesion and intracellular signal transduction.

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Labetuzumab Biosimilar - Anti-CEACAM5 mAb (cat. No.PX-TA1048) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Cibisatamab Biosimilar - Anti-CEACAM5andCD3E;CD3E mAb - Research Grade (cat. No.PX-TA1824) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.461M.

Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade (cat. No.PX-TA1077) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.80M.

Cergutuzumab Biosimilar - Anti-CEACAM5, CEA, CD66e mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Cergutuzumab Biosimilar - Anti-CEACAM5, CEA, CD66e mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Cergutuzumab Biosimilar - Anti-CEACAM5, CEA, CD66e mAb (cat. No.PX-TA1387) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “CD66e Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products