Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tinurilimab Biosimilar – Anti-CEACAM6 mAb – Research Grade

Isotype:
IgG1, kappa

Original price was: €113.00.Current price is: €84.00.

50ug 26% OFF + 84 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade

Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1609-50
Uniprot ID P40199
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade
Uniprot ID P40199
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tinurilimab ,BAY-1834942,CEACAM6,anti-CEACAM6
Reference PX-TA1609
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Introduction:

Tinurilimab Biosimilar, also known as Anti-CEACAM6 mAb, is a research grade monoclonal antibody that has shown promising results in targeting a specific protein known as CEACAM6. This article will provide a detailed scientific description of the structure, activity, and potential applications of Tinurilimab Biosimilar as an antibody therapy.

Structure of Tinurilimab Biosimilar:

Tinurilimab Biosimilar is a monoclonal antibody, meaning it is produced by identical immune cells and is designed to target a specific antigen. The structure of Tinurilimab Biosimilar is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains contain only a variable region. The variable regions are responsible for binding to the target antigen, CEACAM6, while the constant regions provide stability and effector functions.

Activity of Tinurilimab Biosimilar:

The primary activity of Tinurilimab Biosimilar is its ability to bind to CEACAM6, a cell surface protein that is overexpressed in many types of cancer. This binding is highly specific and allows Tinurilimab Biosimilar to selectively target cancer cells while sparing healthy cells. Once bound to CEACAM6, Tinurilimab Biosimilar can trigger various immune responses, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), leading to the destruction of cancer cells.

In addition to its direct activity against

cancer cells, Tinurilimab Biosimilar also has the potential to modulate the tumor microenvironment. CEACAM6 has been shown to play a role in promoting tumor growth and metastasis, and by targeting this protein, Tinurilimab Biosimilar may help to inhibit these processes.

Applications of Tinurilimab Biosimilar:

Tinurilimab Biosimilar has the potential to be used in a variety of applications, particularly in the field of oncology. As a monoclonal antibody, it can be used as a targeted therapy for various types of cancer, including lung, breast, and colorectal cancer. It may also be effective in combination with other cancer treatments, such as chemotherapy or immunotherapy.

In addition to its potential as a cancer therapy, Tinurilimab Biosimilar may also have applications in autoimmune diseases. CEACAM6 has been implicated in the development of autoimmune disorders, and by targeting this protein, Tinurilimab Biosimilar may help to alleviate symptoms and slow disease progression.

Conclusion:

In conclusion, Tinurilimab Biosimilar is a research grade monoclonal antibody with a specific structure and activity. Its primary function is to bind to the cell surface protein CEACAM6 and trigger immune responses against cancer cells. It has the potential to be used in a variety of applications, including as a targeted therapy for cancer and in the treatment of autoimmune diseases. Further research and clinical trials are needed to fully explore the potential of Tinurilimab Biosimilar as a therapeutic antibody.

SDS-PAGE for Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade

SDS-PAGE for Tinurilimab  Biosimilar - Anti-CEACAM6 mAb - Research Grade

Tinurilimab Biosimilar - Anti-CEACAM6 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tinurilimab  Biosimilar - Anti-CEACAM6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tinurilimab Biosimilar – Anti-CEACAM6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products