Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1103-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody

Original price was: €334.00.Current price is: €259.00.

50ug 22% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody
Product name PX-TA1103-50
Uniprot ID P06731
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms cT84.66,90Y-cT84.66,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1103
Note For research use only. Not suitable for clinical or therapeutic use.
Clonality Monoclonal Antibody

Introduction

cT84.66 Biosimilar, also known as Anti-CEACAM5, CD66e mAb, is a monoclonal antibody that has been developed as a biosimilar to the original cT84.66 antibody. It is a research grade antibody that specifically targets the CEACAM5 protein, also known as CD66e, which is overexpressed in various cancers. In this article, we will discuss the structure, activity, and potential applications of cT84.66 Biosimilar in the field of cancer research.

Structure of cT84.66 Biosimilar

cT84.66 Biosimilar is a monoclonal antibody that is produced by cloning the gene for the cT84.66 antibody into a mammalian cell line. The resulting antibody has the same amino acid sequence and structure as the original cT84.66 antibody. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the CEACAM5 protein, while the constant regions determine the antibody’s effector functions.

Activity of cT84.66 Biosimilar

cT84.66 Biosimilar specifically targets the CEACAM5 protein, which is overexpressed in various cancers, including colorectal, lung, and breast cancer. The antibody binds to the CEACAM5 protein on the surface of cancer cells, leading to the activation of immune cells and subsequent destruction of the cancer cells. This mechanism of action is known as antibody-dependent cellular cytotoxicity (ADCC).

In addition to its anti-tumor activity, cT84.66 Biosimilar has also been shown to inhibit the growth and proliferation of cancer cells by blocking the interaction between CEACAM5 and other proteins involved in cancer progression. This makes it a promising therapeutic agent for the treatment of CEACAM5-positive cancers.

Applications of cT84.66 Biosimilar

cT84.66 Biosimilar has potential applications in both research and clinical settings. In research, it can be used as a tool to study the role of CEACAM5 in cancer development and progression. The antibody can also be used in diagnostic assays to detect the presence of CEACAM5 in patient samples.

In the clinical setting, cT84.66 Biosimilar has the potential to be used as a therapeutic agent for the treatment of CEACAM5-positive cancers. It can be administered alone or in combination with other cancer treatments, such as chemotherapy or radiation therapy. The antibody’s ability to activate the immune system and inhibit cancer cell growth makes it a promising candidate for cancer immunotherapy.

Conclusion

cT84.66 Biosimilar, also known as Anti-CEACAM5, CD66e mAb, is a research grade monoclonal antibody that specifically targets the CEACAM5 protein, which is overexpressed in various cancers. Its structure is identical to the original cT84.66 antibody, and it exerts its activity through ADCC and inhibition of cancer cell growth. With potential applications in both research and clinical settings, cT84.66 Biosimilar shows promise as a therapeutic agent for the treatment of CEACAM5-positive cancers. Further studies and clinical trials are needed to fully evaluate its efficacy and safety.

SDS-PAGE for cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in ELISA Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade in WB Assay

cT84.66 Biosimilar - Anti-CD66e;CEA mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

cT84.66 Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “cT84.66 Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products