Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade

  • PX-TA1077-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-nd

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

Product name Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody
Product name PX-TA1077-50
Uniprot ID P06731
Source CAS 154361-48-5
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Molecular weight 50kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Arcitumomab,CEA-Scan,IMMU-4,CEACAM5, CD66e,anti-CEACAM5, CD66e
Reference PX-TA1077
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-nd
Clonality Monoclonal Antibody

Title: Understanding the Structure and Function of Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb

Introduction:

Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb is a monoclonal antibody that has been developed as a biosimilar to the original Arcitumomab antibody. It is designed to target the carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), also known as CD66e, which is a protein found on the surface of many cancer cells. In this article, we will explore the structure, activity, and potential applications of this biosimilar in scientific research.

Structure:

Arcitumomab Biosimilar is a recombinant monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It is composed of two identical heavy chains and two identical light chains, which are connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL2) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for binding to the specific target, CEACAM5.

Activity:

Arcitumomab Biosimilar binds specifically to CEACAM5, a glycoprotein that is overexpressed in various types of cancer, including colorectal, breast, and lung cancer. This binding occurs through the variable domains of the antibody, which recognize and bind to specific regions on the CEACAM5 protein. This binding triggers a series of events that lead to the destruction of the cancer cells, either by activating the body’s immune system or by directly inhibiting the growth and survival of the cancer cells.

Application:

The primary application of Arcitumomab Biosimilar is in the field of cancer research. Its ability to target and bind to CEACAM5 makes it a valuable tool for studying the role of this protein in different types of cancer. It can also be used to investigate the efficacy of other potential cancer therapies that target CEACAM5. Additionally, Arcitumomab Biosimilar can be used in diagnostic imaging, as it has been labeled with a radioactive isotope to detect the presence of CEACAM5 in cancer cells.

Therapeutic Potential:

Apart from its use in research, Arcitumomab Biosimilar also has therapeutic potential. It has been shown to be effective in clinical trials for the treatment of colorectal cancer, both as a standalone treatment and in combination with other chemotherapy drugs. Its ability to specifically target CEACAM5 makes it a promising option for targeted cancer therapy, which aims to minimize the side effects of traditional chemotherapy.

Conclusion:

In summary, Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb is a recombinant monoclonal antibody that targets the cancer-associated protein CEACAM5. Its structure consists of two heavy chains and two light chains, and its activity involves binding to CEACAM5 and triggering the destruction of cancer cells. This biosimilar has potential applications in cancer research and therapy, and its development marks a significant advancement in the field of targeted cancer treatment.

Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade binds to CD66e Recombinant Protein in ELISA assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind Arcitumomab Biosimilar - Anti-CD66e,CEA mAb - Research Grade (cat. No.PX-TA1077) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 13.80M.

SDS-PAGE for Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

SDS-PAGE for Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade

Arcitumomab Biosimilar - Anti-CD66e;CEA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Arcitumomab Biosimilar - Anti-CEACAM5, CD66e mAb - Research Grade

There are no reviews yet.

Be the first to review “Arcitumomab Biosimilar – Anti-CEACAM5, CD66e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products