Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Labetuzumab Biosimilar – Anti-CEACAM5 mAb – Research Grade

  • PX-TA1048-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG-nd

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade

Product name Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody
Product name Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody
Product name PX-TA1048-50
Uniprot ID P06731
Source CAS 219649-07-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Labetuzumab,hMN14,CEACAM5,anti-CEACAM5
Reference PX-TA1048
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG-nd
Clonality Monoclonal Antibody

Introduction

Labetuzumab Biosimilar, also known as Anti-CEACAM5 mAb, is a monoclonal antibody that has been developed as a biosimilar to the original Labetuzumab. This antibody specifically targets the carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), which is overexpressed in various types of cancer. In this article, we will discuss the structure, activity, and potential applications of Labetuzumab Biosimilar in the field of cancer research.

Structure of Labetuzumab Biosimilar

Labetuzumab Biosimilar is a recombinant, humanized IgG1 monoclonal antibody that has been engineered to have a similar structure to the original Labetuzumab. It consists of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain constant regions (Fc) and variable regions (Fab), while the light chains contain only variable regions. The variable regions are responsible for binding to the target antigen, CEACAM5, while the constant regions are involved in effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Labetuzumab Biosimilar

Labetuzumab Biosimilar binds specifically to CEACAM5, a glycoprotein that is overexpressed in a variety of cancers, including colorectal, pancreatic, and lung cancer. This binding inhibits the growth and spread of cancer cells by blocking the interaction between CEACAM5 and its ligands, which are involved in cell adhesion and signaling pathways. Additionally, Labetuzumab Biosimilar can induce ADCC and CDC, leading to the destruction of cancer cells by the immune system.

Potential Applications of Labetuzumab Biosimilar

Labetuzumab Biosimilar has shown promising results in preclinical and clinical studies as a potential therapeutic agent for various types of cancer. Here are some potential applications of this antibody:

1. Treatment of Colorectal

Cancer CEACAM5 is highly expressed in colorectal

cancer cells, making it an ideal target for Labetuzumab Biosimilar. In a phase II clinical trial, Labetuzumab Biosimilar showed promising results in combination with chemotherapy in patients with metastatic colorectal cancer. It significantly improved progression-free survival and overall survival compared to chemotherapy alone.

2. Treatment of Pancreatic

Cancer Pancreatic

cancer is one of the most aggressive and difficult-to-treat cancers. CEACAM5 is overexpressed in pancreatic cancer cells, and Labetuzumab Biosimilar has shown efficacy in preclinical studies. A phase I clinical trial is currently ongoing to evaluate the safety and efficacy of Labetuzumab Biosimilar in combination with chemotherapy in patients with advanced pancreatic cancer.

3. Treatment of Lung

Cancer CEACAM5 is also overexpressed in lung

cancer cells, and Labetuzumab Biosimilar has shown promising results in preclinical studies. A phase II clinical trial is currently ongoing to evaluate the safety and efficacy of Labetuzumab Biosimilar in combination with chemotherapy in patients with advanced non-small cell lung cancer.

4. Research Tool for

Cancer Studies

In addition to its potential therapeutic applications, Labetuzumab Biosimilar can also serve as a valuable research tool for studying the role of CEACAM5 in cancer development and progression. It can be used in various techniques such as flow cytometry, immunohistochemistry, and Western blotting to detect and quantify CEACAM5 expression in cancer cells.

Conclusion

Labetuzumab Biosimilar is a promising biosimilar of the original Labetuzumab, with a similar structure and activity. Its specific targeting of CEACAM5, a protein overexpressed in various types of cancer, makes it a potential therapeutic agent for colorectal, pancreatic, and lung cancer. Furthermore, it can also serve as a valuable research tool for studying the role of CEACAM5 in cancer. Further clinical trials are needed to fully evaluate the efficacy and safety of Labetuzumab Biosimilar, but it holds great

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Labetuzumab Biosimilar - Anti-CEACAM5 mAb binds to CD66e Recombinant Protein in indirect ELISA Assay

Immobilized CD66e Recombinant Protein (cat. No.PX-P4089) at 0.5µg/mL (100µL/well) can bind to Labetuzumab Biosimilar - Anti-CEACAM5 mAb (cat. No.PX-TA1048) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Labetuzumab Biosimilar - Anti-CEACAM5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Labetuzumab Biosimilar – Anti-CEACAM5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products