Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Flotetuzumab Biosimilar – Anti-CD3E, IL3RA, CD123 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VL-VH'-VL'

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade

Product name Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody
Product name Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody
Product name PX-TA1456-50
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody

Introduction

Flotetuzumab Biosimilar is a novel antibody that targets three key proteins – CD3E, IL3RA, and CD123. This unique antibody has shown promising results in pre-clinical studies and has the potential to be a game-changer in the field of cancer treatment. In this article, we will delve deeper into the structure, activity, and potential applications of Flotetuzumab Biosimilar as a research-grade antibody.

Structure of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a biosimilar version of the original Flotetuzumab, which was developed by MacroGenics, Inc. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL). The variable domains are responsible for binding to the target proteins, while the constant domains provide stability and effector functions.

Activity of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar targets three proteins – CD3E, IL3RA, and CD123 – which are all involved in promoting the growth and survival of cancer cells. By binding to these proteins, Flotetuzumab Biosimilar blocks their signaling pathways, leading to the inhibition of cancer cell growth and induction of cell death. This makes Flotetuzumab Biosimilar a potent anti- cancer agent with the potential to treat a wide range of cancers, including acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), and myelodysplastic syndromes (MDS).

The antibody also has the ability to activate the immune system by recruiting and activating natural killer (NK) cells, which can directly kill cancer cells. This dual mechanism of action makes Flotetuzumab Biosimilar a promising therapeutic option for cancer treatment.

Potential Applications of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar is currently being studied in pre-clinical and clinical trials for the treatment of various types of cancer. In a phase I clinical trial, Flotetuzumab Biosimilar showed promising results in patients with relapsed or refractory AML, with an overall response rate of 60%. The antibody is also being evaluated in combination with other therapies, such as chemotherapy and checkpoint inhibitors, to enhance its anti- cancer effects.

Apart from its potential as a therapeutic agent, Flotetuzumab Biosimilar also has applications in research. Its ability to specifically target CD3E, IL3RA, and CD123 makes it a valuable tool for studying the role of these proteins in cancer development and progression. The biosimilar version of Flotetuzumab also provides a more cost-effective option for researchers compared to the original version.

Conclusion

In summary, Flotetuzumab Biosimilar is a novel antibody that targets CD3E, IL3RA, and CD123, and has shown promising results in pre-clinical and clinical studies. Its unique structure and dual mechanism of action make it a potent anti- cancer agent with the potential to treat a wide range of cancers. In addition, Flotetuzumab Biosimilar has applications in research and provides a more cost-effective option for studying the role of its target proteins in cancer. Further studies and clinical trials are needed to fully understand the potential of this antibody in cancer treatment.

SDS-PAGE for Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade

SDS-PAGE for Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade

Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products