Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vibecotamab Biosimilar – Anti-CD3 epsilon, IL3RA mAb – Research Grade

  • PX-TA1564-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-kappa / scFv-h-CH2-CH3

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade

Product name Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name Vibecotamab Biosimilar - Anti-CD3 epsilon, IL3RA mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1564-50
Uniprot ID P26951 & P07766
Source CAS 2138442-13-2
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vibecotamab ,XmAb14045,CD3 epsilon, IL3RA,anti-CD3 epsilon, IL3RA
Reference PX-TA1564
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa / scFv-h-CH2-CH3
Clonality Monoclonal Antibody

Introduction

Vibecotamab Biosimilar, also known as Anti-CD3 epsilon, IL3RA mAb, is a monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody, Vibecotamab. This biosimilar is designed to target the CD3 epsilon subunit of the IL3RA receptor, making it a promising therapeutic option for a variety of diseases.

Structure

Vibecotamab Biosimilar is a fully humanized IgG1 monoclonal antibody, which means it is derived from human cells and has a structure similar to natural human antibodies. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of around 21 days in the human body.

Activity

The main function of Vibecotamab Biosimilar is to bind to the CD3 epsilon subunit of the IL3RA receptor. This subunit is found on the surface of T cells, which are a type of white blood cell involved in the immune response. By binding to the CD3 epsilon subunit, Vibecotamab Biosimilar activates T cells and stimulates their proliferation, leading to an enhanced immune response.

Application

Vibecotamab Biosimilar has shown promising results in preclinical studies for the treatment of various diseases. Its main application is in the field of oncology, where it has been studied as a potential treatment for various types of cancer, including solid tumors and hematological malignancies. The antibody has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis.

In oncology, Vibecotamab Biosimilar has been shown to induce tumor cell death through the activation of T cells. This mechanism of action makes it a promising option for the treatment of solid tumors, which are often difficult to target with traditional therapies. In addition, the antibody has been shown to have a synergistic effect when combined with other cancer treatments, such as chemotherapy and radiation therapy.

In autoimmune diseases, Vibecotamab Biosimilar has been shown to modulate the immune response, leading to a reduction in inflammation and disease symptoms. This makes it a potential treatment option for patients who do not respond well to traditional therapies or experience significant side effects.

Research Grade

Vibecotamab Biosimilar is currently in the research grade stage, which means it is still undergoing preclinical and clinical studies to determine its safety and efficacy in humans. These studies are necessary before the antibody can be approved for use in patients.

Conclusion

In summary, Vibecotamab Biosimilar is a promising monoclonal antibody that targets the CD3 epsilon subunit of the IL3RA receptor. Its structure, activity, and potential applications make it a promising therapeutic option for a variety of diseases, particularly in the fields of oncology and autoimmune diseases. With continued research and development, this biosimilar has the potential to improve patient outcomes and contribute to the advancement of medical treatments.

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade binds to CD3E Recombinant Protein in ELISA assay

Immobilized CD3E Recombinant Protein (cat. No.PX-P4075) at 0.5µg/mL (100µL/well) can bind Vibecotamab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade (cat. No.PX-TA1564) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 2.045M.

Vibecotamab  Biosimilar - Anti-CD3 epsilon,  IL3RA mAb - Research Grade

There are no reviews yet.

Be the first to review “Vibecotamab Biosimilar – Anti-CD3 epsilon, IL3RA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products