Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Caspase-1(CASP1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P29466
Molecular weight:
19.85 kDa

€182.00

50ug + 182 loyalty points
Asn120–Asp297
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Caspase-1(CASP1)

Caspase-1(CASP1)

Product name Caspase-1(CASP1)
Uniprot ID P29466
Uniprot link https://www.uniprot.org/uniprot/P29466
Expression system Prokaryotic expression
Sequence NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Molecular weight 19.85 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn120-Asp297
Aliases /Synonyms CASP-1,Interleukin-1 beta convertase,IL-1BC,Interleukin-1 beta-converting enzyme,ICE,IL-1 beta-converting enzyme,p45,IL1BC, IL1BCE
Reference PX-P4722
Note For research use only
Molecular Constructor
Asn120–Asp297
Product name Caspase-1(CASP1)
Uniprot ID P29466
Uniprot link https://www.uniprot.org/uniprot/P29466
Expression system Prokaryotic expression
Sequence NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Molecular weight 19.85 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn120-Asp297
Aliases /Synonyms CASP-1,Interleukin-1 beta convertase,IL-1BC,Interleukin-1 beta-converting enzyme,ICE,IL-1 beta-converting enzyme,p45,IL1BC, IL1BCE
Reference PX-P4722
Note For research use only
Molecular Constructor
Asn120–Asp297

There are no reviews yet.

Be the first to review “Caspase-1(CASP1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products