Name: Caspase-1(CASP1)
SKU: PX-P4722-10
Availability: InStock

Product name	Caspase-1(CASP1)
Uniprot ID	P29466
Uniprot link	https://www.uniprot.org/uniprot/P29466
Expression system	Prokaryotic expression
Sequence	NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Molecular weight	19.85 kDa
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Asn120-Asp297
Aliases /Synonyms	CASP-1,Interleukin-1 beta convertase,IL-1BC,Interleukin-1 beta-converting enzyme,ICE,IL-1 beta-converting enzyme,p45,IL1BC, IL1BCE
Reference	PX-P4722
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Caspase-1(CASP1)”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.