Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Glycine oxidase (thiO) (3-369)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
S5FMM4 (98,4%)
Molecular weight:
67.01kDa

Original price was: €242.00.Current price is: €210.00.

50ug 13% OFF + 210 loyalty points
Lys3–Arg369
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Glycine oxidase (thiO) (3-369)

Product name Glycine oxidase (thiO) (3-369)
Uniprot ID S5FMM4 (98,4%)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight 67.01kDa
Purity estimated >90% by SDS-PAGE
Buffer 30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys3-Arg369
Aliases /Synonyms Glycine oxidase, GO, thiO
Reference PX-P4364
Note For research use only
Molecular Constructor
Lys3–Arg369
Product name Glycine oxidase (thiO) (3-369)
Uniprot ID S5FMM4 (98,4%)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight 67.01kDa
Purity estimated >90% by SDS-PAGE
Buffer 30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys3-Arg369
Aliases /Synonyms Glycine oxidase, GO, thiO
Reference PX-P4364
Note For research use only
Molecular Constructor
Lys3–Arg369
Product name PX-P4364-1MG
Uniprot ID S5FMM4 (98,4%)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight 67.01kDa
Purity estimated >90% by SDS-PAGE
Buffer 30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys3-Arg369
Aliases /Synonyms Glycine oxidase, GO, thiO
Reference PX-P4364
Note For research use only
Molecular Constructor
Lys3–Arg369

Glycine oxidase (thiO) (3-369)

There are no reviews yet.

Be the first to review “Glycine oxidase (thiO) (3-369)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products