Brand: ProteoGenix

Glycine oxidase (thiO) (3-369)

PX-P4364-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: S5FMM4 (98,4%)
Molecular weight:: 67.01kDa

€210.00

50ug + 210 loyalty points

Lys3–Arg369

size size

50ug €210.00
100ug €394.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Glycine oxidase (thiO) (3-369)

Product name	Glycine oxidase (thiO) (3-369)
Uniprot ID	S5FMM4 (98,4%)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight	67.01kDa
Purity estimated	>90% by SDS-PAGE
Buffer	30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys3-Arg369
Aliases /Synonyms	Glycine oxidase, GO, thiO
Reference	PX-P4364
Note	For research use only
Molecular Constructor	Lys3–Arg369

Product name	Glycine oxidase (thiO) (3-369)
Uniprot ID	S5FMM4 (98,4%)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMRKRYDTIVIGGGIIGTSIAYHLAKAGKKTAVFESGEVGKKATSAAAGMLSAHRECDKPGTFFEFARASQKAYKRLTGELRDISGIDIRRHDGGILKLAFSESDREHLMQMGALDSVEWLEADEVYKLEPNAGKGILGANFIRDDVHVEPAAVCRAFARGARMLGADVFEYTPVLSIESEAGAVRVTSASGTAEAEHAVIACGVWSGALFKQIGLDKRFYPVKGECLSVWNDGISLTRTLYHDHCYIVPRHSGRLVVGATMKPGDWNEQPELGGIEELIRKAKSMLPGIESMKIDQCWAGLRPETGDGNPYIGRHPENDRILFAAGHFRNGVLLAPATGEMVADMILGNPVKTEWIEAFKAERKEAVHR
Molecular weight	67.01kDa
Purity estimated	>90% by SDS-PAGE
Buffer	30 mM potassium phosphate pH 8.0, 100 mM NaCl, 10% glycerol
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys3-Arg369
Aliases /Synonyms	Glycine oxidase, GO, thiO
Reference	PX-P4364
Note	For research use only
Molecular Constructor	Lys3–Arg369