UDP-N-acetylmuramoyl-tripeptide–D-alanyl-D-alanine ligase(murF)

Reference:
Product nameUDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase(murF)
Uniprot IDQ8ZRU6
Uniprot linkhttp://www.uniprot.org/uniprot/Q8ZRU6
Expression systemProcaryotic expression
SequenceMGSHHHHHHSGMISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKGERFDAHDFADKAKANGAGALLVSR PLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVALTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLN HDYDYAVIELGANHQGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNNDWLNWQS IIGDRLVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRHNIANALAAAALSMAVGATLTAIKAGLAA LKAVPGRLFPIQLSENQLVLDDAYNANVGSMTAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLS TGKLSQAISHASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC
Molecular weight48.7kDa
Purity estimated90% by SDS-PAGE
BufferPBS, pH 7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment Typefull length
Aliases /SynonymsD-alanine-adding enzyme
ReferencePX-P4519
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “UDP-N-acetylmuramoyl-tripeptide–D-alanyl-D-alanine ligase(murF)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.