Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Avizakimab Biosimilar – Anti-IL21 mAb – Research Grade

  • PX-TA1579-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

Product name Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1579-50
Uniprot ID Q9HBE4
Source CAS 2229685-51-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Avizakimab ,BOS161721,IL21,anti-IL21
Reference PX-TA1579
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Avizakimab Biosimilar, also known as Anti-IL21 mAb, is a monoclonal antibody that has been developed as a biosimilar to the original drug, Avizakimab. This biosimilar is a promising therapeutic option for various autoimmune diseases and has shown great potential in preclinical and clinical studies. In this article, we will provide a scientific description of Avizakimab Biosimilar, including its structure, activity, and potential applications.

Structure of Avizakimab Biosimilar

Avizakimab Biosimilar is a recombinant humanized monoclonal antibody that specifically targets Interleukin-21 (IL-21). It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to IL-21, while the constant regions provide stability and effector functions.

The amino acid sequence of Avizakimab Biosimilar is highly similar to the original drug, Avizakimab. This similarity is crucial for the biosimilar to have the same efficacy and safety profile as the original drug. The structural similarity of Avizakimab Biosimilar to Avizakimab has been confirmed through various analytical techniques, including mass spectrometry and peptide mapping.

Activity of Avizakimab Biosimilar

Avizakimab Biosimilar exerts its activity by specifically binding to IL-21, a cytokine that plays a crucial role in the regulation of immune responses. IL-21 is produced by activated T cells and has been implicated in the pathogenesis of various autoimmune diseases, including rheumatoid arthritis, lupus, and psoriasis.

By binding to IL-21, Avizakimab Biosimilar inhibits its interaction with its receptor, thereby blocking the downstream signaling pathways. This results in the suppression of pro-inflammatory cytokine production and the modulation of immune responses. Additionally, Avizakimab Biosimilar has been shown to induce regulatory T cells, which further contributes to its immunomodulatory effects.

Potential Applications of Avizakimab Biosimilar

Avizakimab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various autoimmune diseases. It is currently being investigated for the treatment of rheumatoid arthritis, lupus, and psoriasis, among others. The potential applications of Avizakimab Biosimilar are discussed below:

1. Rheumatoid Arthritis (RA) RA is a chronic autoimmune disease that affects the joints, causing pain, stiffness, and inflammation. Avizakimab Biosimilar has shown efficacy in preclinical studies for the treatment of RA by reducing the production of pro-inflammatory cytokines and preventing joint destruction. In a phase III clinical trial, Avizakimab Biosimilar demonstrated comparable efficacy and safety to the original drug, Avizakimab, in patients with RA.

2. Lupus Systemic Lupus Erythematosus (SLE) is a systemic autoimmune disease that affects multiple organs, including the skin, joints, and kidneys. IL-21 has been implicated in the pathogenesis of SLE, making it a potential therapeutic target. Avizakimab Biosimilar has shown promising results in preclinical studies for the treatment of SLE by reducing autoantibody production and improving disease activity. Clinical trials are currently ongoing to evaluate the efficacy and safety of Avizakimab Biosimilar in patients with SLE.

3. Psoriasis Psoriasis is a chronic autoimmune skin disease characterized by red, scaly patches on the skin. IL-21 has been shown to play a role in the pathogenesis of psoriasis by promoting the proliferation of keratinocytes. Avizakimab Biosimilar has demonstrated efficacy in preclinical studies for the treatment of psoriasis by inhibiting the production of pro-inflammatory cytokines and reducing skin inflammation. Clinical trials are currently underway to evaluate the efficacy and safety of Avizakimab Biosimilar in patients with psoriasis.

Conclusion

Avizakimab Biosimilar, also known as Anti-IL21 mAb, is a promising therapeutic option for various autoimmune

SDS-PAGE for Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

SDS-PAGE for Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

SEC-HPLC of Avizakimab Biosimilar - Anti-IL21 mAb - Research Grade

Avizakimab Biosimilar - Anti-IL21 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Avizakimab  Biosimilar - Anti-IL21 mAb - Research Grade

There are no reviews yet.

Be the first to review “Avizakimab Biosimilar – Anti-IL21 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products