Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Spesolimab Biosimilar – Anti-IL36RN mAb – Research Grade

  • PX-TA1537-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

Product name Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1537-50
Uniprot ID Q9UBH0
Source CAS 2097104-58-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Spesolimab,BI 655130,IL36RN,anti-IL36RN
Reference PX-TA1537
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Spesolimab Biosimilar, also known as Anti-IL36RN mAb, is a monoclonal antibody that targets the cytokine IL-36 receptor antagonist (IL-36RN). This biosimilar is currently in the research grade stage and shows promising potential as a therapeutic agent for various inflammatory diseases.

Structure of Spesolimab Biosimilar

Spesolimab Biosimilar is a fully humanized monoclonal antibody, meaning it is derived from human cells and has a structure similar to natural antibodies found in the body. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The variable regions of the antibody are responsible for binding to the IL-36RN cytokine, while the constant regions determine the effector functions of the antibody.

Activity of Spesolimab Biosimilar

Spesolimab Biosimilar works by specifically targeting and binding to the IL-36RN cytokine, which is a key mediator of inflammation. This binding prevents the cytokine from binding to its receptor, thereby inhibiting its activity and reducing inflammation. IL-36RN is known to play a role in various inflammatory diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. By targeting this cytokine, Spesolimab Biosimilar has the potential to effectively treat these conditions.

Application of Spesolimab Biosimilar

Spesolimab Biosimilar has shown promising results in preclinical studies for the treatment of various inflammatory diseases. It has been found to be effective in reducing inflammation and improving symptoms in animal models of psoriasis, rheumatoid arthritis, and inflammatory bowel disease. This makes it a potential candidate for the treatment of these conditions in humans.

Psoriasis is a chronic skin disease characterized by red, scaly patches on the skin. It is caused by an overactive immune response, and IL-36RN has been identified as a key mediator of this response. Spesolimab Biosimilar has shown to be effective in reducing psoriasis symptoms in preclinical studies, making it a potential treatment option for this condition.

Rheumatoid arthritis is an autoimmune disease that causes inflammation and damage to the joints. IL-36RN has been found to be elevated in the synovial fluid of patients with rheumatoid arthritis, and Spesolimab Biosimilar has shown to reduce inflammation and joint damage in animal models of this disease. This makes it a potential therapeutic option for rheumatoid arthritis.

Inflammatory bowel disease (IBD) is a group of chronic inflammatory conditions that affect the digestive tract. IL-36RN has been found to play a role in the development and progression of IBD, and Spesolimab Biosimilar has shown to be effective in reducing inflammation and improving symptoms in animal models of this disease. This makes it a potential treatment option for IBD.

Conclusion

In conclusion, Spesolimab Biosimilar is a promising monoclonal antibody that targets the IL-36RN cytokine and has shown potential as a therapeutic agent for various inflammatory diseases. Its structure, activity, and potential applications make it a promising candidate for further research and development. With continued studies and clinical trials, Spesolimab Biosimilar has the potential to provide a new treatment option for patients suffering from inflammatory diseases.

SDS-PAGE for Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

SDS-PAGE for Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Spesolimab Biosimilar - Anti-IL36RN mAb - Research Grade

There are no reviews yet.

Be the first to review “Spesolimab Biosimilar – Anti-IL36RN mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products