Brand: ProteoGenix

Human CD360-IL21R recombinant protein

PX-P6110
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q9HBE5
Molecular weight:: 27.56 kDa

€189.00

100ug + 189 loyalty points

Met1–Glu232 His

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human CD360-IL21R recombinant protein

Product name	Human CD360-IL21R recombinant protein
Uniprot ID	Q9HBE5
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Molecular weight	27.56 kDa
Protein delivered with Tag?	C-Terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Glu232
Aliases /Synonyms	IL21R, NILR, Interleukin-21 receptor, IL-21R, IL-21 receptor, CD360, Novel interleukin receptor
Reference	PX-P6110
Note	For research use only
Molecular Constructor	Met1–Glu232 His